SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000019582 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000019582
Domain Number 1 Region: 66-173
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 482-585
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 3 Region: 198-302
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 353-457
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000019582   Gene: ENSPPYG00000017467   Transcript: ENSPPYT00000020353
Sequence length 586
Comment pep:known_by_projection chromosome:PPYG2:7:11770797:11791716:1 gene:ENSPPYG00000017467 transcript:ENSPPYT00000020353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASETPFTIWMSKEAEMLIGPQPDEKGWGWRLGDGSAAPPFLPQALSFLLLLPLASALQ
PTPLPFQELRLVGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLAFGQGRGPILLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRK
MLTSRAPPTTLPNGKSEGSVRLVGGANLCQGRVEILHIGLWGTVCDDDWGLPDAAVVCRQ
LGCGAAMAATTNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCA
GLGPPALTALPSSATREDWAWHTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLVGG
PGPCRGRVEVLHAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLD
NVGCAGTEARLSDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPR
DGHLRLVNGAHRCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFG
PGRGPILLDNVKCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences H2PLU8
ENSPPYP00000019582 ENSPPYP00000019582 XP_002817864.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]