SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020357 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020357
Domain Number 1 Region: 553-610
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 599-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 515-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 194-244
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000157
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020357
Domain Number - Region: 402-442
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00017
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 
Domain Number - Region: 92-173
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020357   Gene: ENSPPYG00000018151   Transcript: ENSPPYT00000021159
Sequence length 670
Comment pep:known_by_projection chromosome:PPYG2:7:146958693:147001181:1 gene:ENSPPYG00000018151 transcript:ENSPPYT00000021159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLGIQGLGLDSGSWSWAQALPPEEVCHQEPALRGEMAEGMPPMQAQEWD
MDARRPMPFQFPPFPDRAPVFPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQLL
NLEGRTGTAEKKLADCEKTAVEFGNHMESKWAVLGTLLQEYGLLQRRLENLENLLRNRNF
WVLRLPPGSKGEAPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLDAE
GSVPKPDAPAQAEPREEPCVWEQRHPEEREIPMDPEAGAESLVPVQDASSQVKREDTLCV
RGQRGLEERAIPTESITDSPISAQDLLSRIKQEEHQCVWDQQDLADRDIPTDPNSESLIS
AHDILSWIKQEEQPYPWGPRDSMDGELRISGPSDSLLMVKNPPPAPPQPQPQPQPPQPQL
QSQPQPQSLPPIAVAENLGGPPSRGLLDDGFQALPGERGSGEAPPGGDRSTGGGGGDGGG
GGGGAEAGTGAGGGCGSCCPGGLRRSLLLHGARSKPYSCPECGKSFGVRKSLIIHHRSHT
KERPYECAECEKSFNCHSGLIRHQMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERP
FQCALCGKSFIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGAP
RPLPQPPERD
Download sequence
Identical sequences H2PNZ0
9600.ENSPPYP00000020357 ENSPPYP00000020357 ENSPPYP00000020357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]