SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020358 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020358
Domain Number 1 Region: 428-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.21e-18
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 138-183
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000262
Family KRAB domain (Kruppel-associated box) 0.0033
Further Details:      
 
Domain Number 3 Region: 366-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000485
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 313-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000011
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000020358
Domain Number - Region: 48-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.00425
Family Tropomyosin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020358   Gene: ENSPPYG00000018152   Transcript: ENSPPYT00000021160
Sequence length 495
Comment pep:known_by_projection chromosome:PPYG2:7:147015296:147029937:1 gene:ENSPPYG00000018152 transcript:ENSPPYT00000021160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAESAPARHRRKRRSTPLTSSTLPSQATEKSSYFQTTEISLWTVVAAIQAVEKRMESQAA
RLQSLEGRTGTAEKKLADCEKMAVEFGNQLEGKWALLGTLLQEYGLLQRRLENVENLLRN
RNFWILRLPPGSKGEAPKVSRSLENDGVCFTEQEWENLEDWQKELYRNVMESNYETLVSL
KVLGQTEGEAELGTQMLGDLEEEGPGGAHPAGGVMIKQELQYTQEGPADLPGEFSCIAEE
QAFLSPEQTELWGGQGSSVLLETGPGDSTLEEPVGCRDPSSSRTVGCPKQKSHRQVQLGQ
ECGQGLKLKKDTSCPYECSECEITFRYKQQLATHVRSHSGWGSCTPEEPEESLRPRPRLK
PQTKKARLHQCDVCLRSFSCKVSLVTHQRCHLQEGPSAGQHVQERFSPNSLVALPGHIPW
RKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCTECEKSFVQKQHLLQHQKIHQRE
RGGLALEPGRPNGLL
Download sequence
Identical sequences H2PNZ1
ENSPPYP00000020358 XP_002818682.1.23681 ENSPPYP00000020358 9600.ENSPPYP00000020358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]