SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000020368 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000020368
Domain Number 1 Region: 330-387
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 613-884
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000000182
Family Hermes transposase-like 0.011
Further Details:      
 
Domain Number 3 Region: 8-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000275
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 4 Region: 1015-1068
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.0000144
Family Hermes transposase-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000020368   Gene: ENSPPYG00000018161   Transcript: ENSPPYT00000021170
Sequence length 1169
Comment pep:known_by_projection chromosome:PPYG2:7:147668697:147709779:1 gene:ENSPPYG00000018161 transcript:ENSPPYT00000021170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRESGKAPVTFDDITVYLLQEEWVLLSQQQKELCGSDKLVAPLGPTVANPELFCKFGR
GPEPWLGSVQGQRSLLEHHPGKKQKGYMEEMEVQGPTRESGQSLPPQKKACLSHLSTGSG
HIEGDGAGRSRKLLKPRSIQKSWFVQFPWLIMNEEQTALFCCACREYPSIRDKRSRLIEG
YTGPFKVETLKYHAKSKAHMFCVNALAARDPIWAARFRSIRDPPGDVLASPEPLFTADYP
IFYPPGPLGGFDSMAELLPSSRAELEDPGGNGAIPAMYLDCISDLRQKEITDSIHSSSDI
NILYNDAVESCIQDPSAEGLSEEVPVVFEELPVVFEDVAVYFTREEWGMLDKWQKELYRD
VMRMNYELLASLGPAAAKPDLISKLERRAAPWIRDTNGPKWGKSRPPGNKKMVAVREADT
QASAADSALLPASPVEAHASCCSSSICEEGDGPRRIKRTYRPRSIQRSWFGQFPWLVIDP
KETKLFCSACKERPNLHDKSSRLVRGYTGPFKVETLKYHEVSKAHRLCVNTVEIKEDTPH
TALVPEISSDLMANMEHFFNAAYSIAYHSRPLNDFEKILQLLQSTGTMILGKYRNRTACT
QFIKYISETLKREILEDVRNSPCVSVLLDSSTDASEQACVGIYIRYFKQMEVKESYITLA
PLYSETADGYFETIVSALDELDIPFRKPGWVVGLGTDGSDMLSCRGGLVEKFQEVIPQLL
PVHCVAHRLHLAVVDACGSIDLVKKCDRHIRTVFKFYQSSNKRLNELQEGAAPLEQEIIR
LKDLNAVRWVASRRRTLHALLASWPALARHLQSVAEAGGQIGHRAKGMLKLMRGFHFVKF
CHFLLDFLSIYRPLSEVCQKEIVLITEVNATLGRAYVALESLRHQAGPKEEEFNASFKDG
RLHGICLDKLEVAEQRFQADRERTVLTGIEYLQQRFDADRPPQLKNMEVFDTIAWPSGIE
LASFGNDDILTLARYFKCSLPTGYSEEALLEEWLGLKAIAQHLPFSMLCKNALAQHCRFP
LLSKLMAVVVCVPISTSCCERGFKAMNRIRTDERTKLSNEVLNMLMMTAVNGVAVTEYDP
QPAIQHWYLTSSGRRFSHVYACAQVPARSSASARLRKEEMGALYVEESGIQKPPILPSRE
AVEVLKDCIMEPPERLLYPHTSQEAPGMS
Download sequence
Identical sequences H2PP01
ENSPPYP00000020368 ENSPPYP00000020368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]