SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021064 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021064
Domain Number 1 Region: 24-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-91
Family Protein kinases, catalytic subunit 0.000000531
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000021064
Domain Number - Region: 444-483
Classification Level Classification E-value
Superfamily NAP-like 0.0209
Family NAP-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021064   Gene: ENSPPYG00000018780   Transcript: ENSPPYT00000021907
Sequence length 491
Comment pep:known chromosome:PPYG2:8:104839437:105202321:-1 gene:ENSPPYG00000018780 transcript:ENSPPYT00000021907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPV
ESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTE
DEIATILKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNT
VIGTPFWMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPT
FRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKNAKPVSILRDLITEAMEIKAK
RHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTMIEHNSTMLES
DLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDA
MDAKKRRQQNF
Download sequence
Identical sequences A0A2K5DK10 F7A3C1 H2PQW7 H2QWH8
ENSPTRP00000034983 ENSCJAP00000028762 XP_002759408.1.60252 XP_009242249.1.23681 XP_012311233.1.9421 XP_528201.3.37143 ENSPPYP00000021064 ENSCJAP00000028769 ENSPTRP00000034983 ENSPPYP00000021064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]