SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021206 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021206
Domain Number 1 Region: 21-220
Classification Level Classification E-value
Superfamily vWA-like 5.56e-57
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 246-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.32e-30
Family Laminin G-like module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021206   Gene: ENSPPYG00000018902   Transcript: ENSPPYT00000022051
Sequence length 1489
Comment pep:known_by_projection chromosome:PPYG2:8:146771974:147082765:-1 gene:ENSPPYG00000018902 transcript:ENSPPYT00000022051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGLRGNAVAGLLWMLLLLWSGGGGCQAQRAGCKSVHYDLVFLLDTSSSVGKEDFEKVRQ
WVANLVDTFEVGPDRTRVGVVRYSDRPTTAFELGLFGSQEEVKAAARRLAYHGGNTNTGD
ALRYITARSFSPRTGGRPGDRAYKQVAILLTDGRSQDLVLDAAAAAHRAGIRIFAVGVGE
ALKEELEEIASEPKSAHVFHVSDFNAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGG
TKEITGFDLMDLFSVKEILGKRENGAQSSYVRMGSFPVVQSTEDVFPQGLPDEYAFVTTF
RFRKTSRKEDWYIWQVIDQYGIPQVSIRLDGENKAVEYNAVGAVKDAVRVVFRGSRVNDL
FDRDWHKIALSIQAQNVSLYIDCALVQTLPIEERENIDIQGKTVIGKRLYDSVPIDFDLQ
RIVIYCDSRHAELETCCDIPSGPCQVTVVTEPPPPPPPQRPPTPGSEQIGFLKTINCSCP
AGEKGEMGVAGPMGLPGPKGDTGATGLVGAPGPKGEKGDVGIRPFGQGEKGEKGSLGLPG
PPGRDGSKGVRGEPGELGEPGLPGEVGMRGPQGPPGLPGPPGHVGAPGLQGERGEKGTQG
EKGERGLDGFPGKPGEAGQQGRPGPPGVAGPQGEKGDVGPAGPPGVPGLVVQREGLKGEQ
GAPGPRGHQGPPGPPGAPGPIGPEGRDGPPGLQGLRGKKGDVGPPGIPGLLGLQGPPGSP
GVPGPPGPGGSPGLPGEIGFPGKPGPPGPTGPPGKDGLNGPLGLPGIKGEPGERGEDGLP
GKPGLRGEIGEQGLAGRPGEKGEAGLPGAPGFPGVRGEKGDQGEKGELGLPGLKGDRGEK
GEAGPAGPPGLPGTTSLFTPHPRMPGLQGHPGELGPRGPAGPPAACGKVRGSENCALGGQ
CVKGDRGAPIPGSPGSRGDPGIGVAGPPGPSGPPGDKGPPGSRGLPGFPGPQGPAGRDGL
SSLLSPGDINLLAKDVCNDCPPGPPGLPGLPGFKGDKGVPGKPGREGTEGKKGEAGPPGL
PGPPGIAGPQGSQGERGADGEVGQKGDQGHPGVPGFMGPPGNPGPPGADGIAGAAGPPGI
QGSPGKEGPPGPQGPSGLPGIPGEEGKEGRDGKPGPPGEPGKAGEPGLPGPEGARGPPGF
KGHTGDSGTPGPRGEPGAMGPPGQEGLPGKDGDTGPTGPQGPQGPRGPPGKNGSPGSPGE
PGPSGTPGQKGSKGENGSPGLPGFLGPRGPPGEPGEKGVPGKEGVPGKPGEPGFKGERGD
PGIKGDKGPPGGKGQPGDPGIPGHKGHTGLMGPQGPPGENGPAGPPGPPGQPGFPGLRGE
SPSMETLRRLIQEELGKQLETKLAYLLAQMPPAHMKSSQGRPGPPGPPGKDGLPGRAGPM
GEPGRPGQRGLEGPSGPIGPKGERGAKGDPGAPGVGLRGEMGPPGIPGQPGEPGYAKDGL
PGIPGPQGETGPAGHPGPPGPPGPPGQCDPSQCAYFASLAARPGNVKGP
Download sequence
Identical sequences H2PR96
9600.ENSPPYP00000021206 ENSPPYP00000021206 ENSPPYP00000021206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]