SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021213 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021213
Domain Number 1 Region: 452-736
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.43e-82
Family Protein kinases, catalytic subunit 0.000000000129
Further Details:      
 
Domain Number 2 Region: 951-1089
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 1.57e-59
Family FAT domain of focal adhesion kinase 0.000000167
Further Details:      
 
Domain Number 3 Region: 75-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.45e-39
Family First domain of FERM 0.00000275
Further Details:      
 
Domain Number 4 Region: 176-297
Classification Level Classification E-value
Superfamily Second domain of FERM 1.5e-39
Family Second domain of FERM 0.000000406
Further Details:      
 
Domain Number 5 Region: 298-406
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-37
Family Third domain of FERM 0.00000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021213   Gene: ENSPPYG00000018909   Transcript: ENSPPYT00000022058
Sequence length 1095
Comment pep:known_by_projection chromosome:PPYG2:8:148899079:149161173:-1 gene:ENSPPYG00000018909 transcript:ENSPPYT00000022058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLELAGQEALKPAGAIYMEKSGCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNS
STKTHLGTGIERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGASQSFIIRPQKEERALPSIPKLA
NSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVH
QGVYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWI
IMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSN
DCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILM
HGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLS
TILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMV
QTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQEIAMWQPNVEDSTALDLR
GIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPIGN
QHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANL
DRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPA
STHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDV
IDQARLKMLGQTRPH
Download sequence
Identical sequences H2PRA3
ENSPPYP00000021213 ENSPPYP00000021213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]