SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021249 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021249
Domain Number 1 Region: 29-90
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-24
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 2 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.15e-24
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 203-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000739
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 5 Region: 341-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021249   Gene: ENSPPYG00000018943   Transcript: ENSPPYT00000022095
Sequence length 398
Comment pep:known_by_projection chromosome:PPYG2:8:152051490:152056637:1 gene:ENSPPYG00000018943 transcript:ENSPPYT00000022095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDISSPPLTRSALLGTVLPQRGGLAVPMDVAQEPVTFRDVAIYFSREEWACLEPSQRALY
RDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPELQAVQRGPQPGARKSADP
KRHCDHPAWAHKKTHVRRERARERSSFRKGFRLDTDDGQLPRAAPERIDAKPTAFPCQML
TQCCGLRPGRRERRKQRAVELSFICGTCGKALSCHSRLLAHQTVHTGTKAFECPECGQTF
RWASNLQRHQKNHTREKPFCCEACGQAFSLKDRLAQHRKVHTEHRPYSCGDCGKAFKQKS
NLLRHQLVHTGERPFYCADCGKAFRTKENLSHHQRVHSGEKPYTCAECGKSFRWPKGFSI
HRRLHLTKRFYKCGHCGKGFRHLGFFTRHQRTHRHGEV
Download sequence
Identical sequences H2PRD9
9600.ENSPPYP00000021249 ENSPPYP00000021249 ENSPPYP00000021249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]