SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021296 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021296
Domain Number 1 Region: 379-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 323-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 9-71
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.45e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 218-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-17
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 171-201
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000243
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021296   Gene: ENSPPYG00000018990   Transcript: ENSPPYT00000022144
Sequence length 539
Comment pep:known_by_projection chromosome:PPYG2:8:153150206:153167603:-1 gene:ENSPPYG00000018990 transcript:ENSPPYT00000022144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALFLSAPPQAEVTFEDVAVYLSQEEWGRLGPAQRGLYRDVMLETYGNLVSLGVGPAGP
KPGVISQLERGDEPWVLDVQGTSGKEHLRVNSPALGTRTEYKELTSRETFGEEDPQGSEP
VEACDHIRKSEGSPEKLVEQRGPRAVTLTNGESSGESGGSLRLLSRPVPDQRLHKCDICE
QSFEQRSYLNNHKRVHRSKKTNTVRDSGEILSANLVVKEGQRIPTGKKLHYCSYCGKTFR
YSANLVKHQRLHTEEKPYKCDECGKAFSQSCEFINHRRMHSGEIPYRCDECGKTFTRRPN
LMKHQRIHTGEKPYKCGECGKHFSAYSSLIYHQRIHTGEKPYKCNDCGKAFSDGSILIRH
RRTHTGEKPFECKECGKGFTQSSNLIQHQRIHTGEKPYKCNECEKAFIQKTKLVEHQRSH
TGEKPYECNDCGKVFSQSTHLIQHQRIHTGEKPYKCSECGKAFHNSSRLIHHQRLHHGEK
PYKCSDCKKAFSQSTYLIQHRRIHTGEKPYKCSECGKAFRHSSNMCQHQRIHLREDFSM
Download sequence
Identical sequences H2PRI6
ENSPPYP00000021296 ENSPPYP00000021296 XP_009242491.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]