SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000021908 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000021908
Domain Number 1 Region: 58-191,367-589
Classification Level Classification E-value
Superfamily RNI-like 1.18e-39
Family Cyclin A/CDK2-associated p19, Skp2 0.071
Further Details:      
 
Domain Number 2 Region: 671-792
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.11e-31
Family Toll/Interleukin receptor TIR domain 0.00014
Further Details:      
 
Domain Number 3 Region: 296-386
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.00000458
Family Outer arm dynein light chain 1 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000021908   Gene: ENSPPYG00000019548   Transcript: ENSPPYT00000022808
Sequence length 804
Comment pep:known_by_projection chromosome:PPYG2:9:114401937:114412266:1 gene:ENSPPYG00000019548 transcript:ENSPPYT00000022808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLD
LSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQNLALG
AFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHL
DLSSNKIQSIYCKDLQVLHQMPLLNLSLDLSLNAMNFIQPGAFKEIRLHKLTLRNSFDSL
NVMKTCIQGLAGLEVHHLVLGEFRNEKNLEKFDTSALEGLCNLTIEEFRLAYLDYYLDDI
IDLFNCLANVSSFSLVSVTIKSVKDFSYNFGWQHLELVNCKFGQFPTLELKSLKRLTFTA
NKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNDVITMGSNFLG
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLKVLKMAG
NSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPY
KCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQL
LVEVERMECATPSDKQGMPVLSLNITCQMNKTIIGVSVFSVLVVSVVAVLVYKFYFHLML
LAGCIKYGRGENTYDAFVIYSSQDEDWVRNELVKNLEEGVPTFQLCLHYRDFIPGVAIAA
NIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLR
QQVELYRLLSRNTXXXXXXXXXXX
Download sequence
Identical sequences H2PT79
ENSPPYP00000021908 ENSPPYP00000021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]