SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022137 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022137
Domain Number 1 Region: 853-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 623-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000942
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 3 Region: 49-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000103
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 744-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000249
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 798-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 566-626
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 691-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000719
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022137   Gene: ENSPPYG00000019740   Transcript: ENSPPYT00000023046
Sequence length 955
Comment pep:known_by_projection chromosome:PPYG2:9:130485687:130525940:1 gene:ENSPPYG00000019740 transcript:ENSPPYT00000023046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRWQCSCWAWFLLVLVVVAGDTVSTGSTDNSPTSNSLEGGTDATAFWWGEWTKWTACS
RSCGGGVTSQERHCLQQRRKSVPGPGNRTCTGTSKRYQLCRVQECPPDGRSFREEQCVSF
NSHVYNGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGYYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQPPHESRPQPVYYGFSEPASESAESQGLD
GAGLMGFVPHNGSLYGQASSERLGLDNRLFGHPGLDMELGPSQGQETNEVCEQAGGGACE
GPPRGKGFRDRNVTGTPLAGDKDDEEVDTHFASQEFFSANAISDQLLGTGSDLKDFTLNE
TVNSIFAQGAPRSSLAESFFVDYEENEGAGPYLLNGSYLELSSDRVANSSSEAPFPNVST
SLPTSAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRYDG
VEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGYQFRVVRCWKMLSPG
FDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSED
EKLCDPNTRPVGEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPESQ
CQMETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQTRSGPE
CGLAKKPAEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKP
VGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences H2PTV3
ENSPPYP00000022137 XP_002820396.2.23681 XP_002820397.1.23681 ENSPPYP00000022137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]