SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000022161 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000022161
Domain Number 1 Region: 54-104
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000103
Family HLH, helix-loop-helix DNA-binding domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000022161   Gene: ENSPPYG00000019762   Transcript: ENSPPYT00000023072
Sequence length 293
Comment pep:known_by_projection chromosome:PPYG2:9:132670575:132675543:-1 gene:ENSPPYG00000019762 transcript:ENSPPYT00000023072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCSEPDPEVSGVPTVRGFNGSSLSGALSCCEDSAQGSGPPKGPTVAEGPSSCLRRNV
IGERERRKRISLSCERLRALLPQFDGRREDMASVLEMSVQFLRLASALGPSQEQHAILAS
SKEMWHSLQEDVLQLTLSSQIQAGVPDAGTGASSGTQTPDVKAFLESPWSQDLASASPEP
LPHILASSRQWDPANCTSPGTDKCEALLGLCQVRGGLPPFSGPSSLAPWPPGRSLPKSVR
PPLSWPPFSQQQTLPVMSREALGWLGQAGPLALGAAPLGEPAKEDPMFAQEAR
Download sequence
Identical sequences H2PTX7
ENSPPYP00000022161 ENSPPYP00000022161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]