SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023197 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023197
Domain Number 1 Region: 1060-1154
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-23
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 772-865
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 868-962
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-21
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 125-219
Classification Level Classification E-value
Superfamily Immunoglobulin 1.03e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 5 Region: 1156-1243
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 6 Region: 964-1058
Classification Level Classification E-value
Superfamily Immunoglobulin 2.75e-19
Family I set domains 0.0032
Further Details:      
 
Domain Number 7 Region: 316-411
Classification Level Classification E-value
Superfamily Immunoglobulin 5.35e-19
Family I set domains 0.021
Further Details:      
 
Domain Number 8 Region: 414-501
Classification Level Classification E-value
Superfamily Immunoglobulin 8.04e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 9 Region: 220-314
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 679-769
Classification Level Classification E-value
Superfamily Immunoglobulin 3.45e-16
Family I set domains 0.0049
Further Details:      
 
Domain Number 11 Region: 32-121
Classification Level Classification E-value
Superfamily Immunoglobulin 6.64e-16
Family I set domains 0.0076
Further Details:      
 
Domain Number 12 Region: 585-676
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000321
Family I set domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023197   Gene: ENSPPYG00000020720   Transcript: ENSPPYT00000024168
Sequence length 1332
Comment pep:known_by_projection chromosome:PPYG2:X:130716193:130732231:-1 gene:ENSPPYG00000020720 transcript:ENSPPYT00000024168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWKTGRGHMLKTSLFVFSGMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRSPSRI
SSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELE
APGQLPKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIF
SIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAPGESL
NLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQTLKIQDTGHYLCFYYDASYR
GSLLSDVLKIWVTDTFPKTWLFAWPSAVVQMGQNVSLWCRGPVDGVGLALYKKGEDKPLQ
FLDATSIDDNTSFFLNNVTYSDTGIYSCHYLFTWKTSIRMPSHNTVELTVVDKPPKPSLS
AWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTGTYSC
SYRVETHPNIWSHRSEPLKLMGPAGYLTWNYILNEAIRLSLIMQLVALLLVVLWIRWKCR
RLRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNFPLAP
WKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHCHSWE
EMAVSEPSEALELVGTDILPKPVISASPPIRGQELQLRCKGWLAGMGFALYKEGEQEPVQ
QLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPFFKTW
ASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVGIGDG
GNYSCRYYDFSIWSEPSNPVELVVTEFYPKPTLLAQPGPVVFPGKSVTLRCQGTFQGMRF
ALLQEGAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPLMIWV
TDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSNDGAFP
ITNISGASMGRYSCCYHPDWTSSIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENMT
LQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDSAPFA
ASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQ
FSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVGNIVR
SSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPANSPSST
SQRISVELPVPI
Download sequence
Identical sequences H2PWS5
ENSPPYP00000023197 ENSPPYP00000023197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]