SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023465 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023465
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 1.07e-38
Family Rap30/74 interaction domains 0.000000524
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.52e-24
Family DNA-binding domain from rap30 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023465   Gene: ENSPPYG00000025829   Transcript: ENSPPYT00000029308
Sequence length 249
Comment pep:novel chromosome:PPYG2:1:57501361:57502107:1 gene:ENSPPYG00000025829 transcript:ENSPPYT00000029308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSKQWGKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKGDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILREIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
Download sequence
Identical sequences H2PXH2
9600.ENSPPYP00000023465 ENSPPYP00000023465 ENSPPYP00000023465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]