SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023558 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023558
Domain Number 1 Region: 344-691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.89e-39
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.24e-27
Family PHD domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023558
Domain Number - Region: 68-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0048
Family PHD domain 0.023
Further Details:      
 
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0048
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023558   Gene: ENSPPYG00000025934   Transcript: ENSPPYT00000029413
Sequence length 706
Comment pep:novel chromosome:PPYG2:13_random:5834419:5836536:1 gene:ENSPPYG00000025934 transcript:ENSPPYT00000029413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESKPGDSQNLACVFCRKNDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYERCDVRRCRC
KEGRDYNASDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGDFQKAKK
RVLPNSNNVGITDCLLEESSPKLPRQSPGAQSKDLLRQGSKFRRNVSTLLIELGFQIKKK
TKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPE
NTQPILDDVSDFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLV
KDILVYHVIQRVHAPFESFKQGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFT
VHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDF
PVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLGKEESSHYIGH
Download sequence
Identical sequences H2PXR4
ENSPPYP00000023558 9600.ENSPPYP00000023558 ENSPPYP00000023558 XP_002833789.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]