SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023584 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023584
Domain Number 1 Region: 245-345
Classification Level Classification E-value
Superfamily HMG-box 6.41e-24
Family HMG-box 0.00000155
Further Details:      
 
Domain Number 2 Region: 518-616
Classification Level Classification E-value
Superfamily HMG-box 2.09e-22
Family HMG-box 0.00000378
Further Details:      
 
Domain Number 3 Region: 103-185
Classification Level Classification E-value
Superfamily HMG-box 2.36e-21
Family HMG-box 0.00000347
Further Details:      
 
Domain Number 4 Region: 355-432
Classification Level Classification E-value
Superfamily HMG-box 6.68e-17
Family HMG-box 0.00000966
Further Details:      
 
Domain Number 5 Region: 443-522
Classification Level Classification E-value
Superfamily HMG-box 0.00000000000000144
Family HMG-box 0.00000536
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000023584
Domain Number - Region: 635-662
Classification Level Classification E-value
Superfamily ARM repeat 0.0138
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023584   Gene: ENSPPYG00000008337   Transcript: ENSPPYT00000032851
Sequence length 727
Comment pep:known_by_projection chromosome:PPYG2:17:45237091:45250720:1 gene:ENSPPYG00000008337 transcript:ENSPPYT00000032851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAF
KDFSGDMCKLKWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYF
RFFMEKRAKYAKLHPEMSNLDLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFR
EDHPDLIQNAKKSDIPEKPKTPQQLWYTHEKKVYLKVRPDEIMRDYIQKHPELNISEEGI
TKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMKDVPSTERMVLCSQQWKLLSQ
KEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQ
EGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK
AREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEM
TWNNMEKKEKLMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQK
FSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSL
SPQDRAAYKEYISNKRKSMTKLRGPNPKSSRTTLQSKSESEEDDEEDEDDEDEDEEEEDD
ENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDDDEDEDNESEGSSSSSSSSGD
SSDSDSN
Download sequence
Identical sequences A0A2K5K9L5 A0A2K5WWD0 A0A2K5Y323 A0A2K6E0X6 A0A2K6N3A8 A0A2K6PX98 G3RUE2 H9FZB2 K7CPC0 K7ESR7
NP_001070151.1.87134 NP_001070151.1.92137 NP_001070152.1.87134 NP_001070152.1.92137 XP_002827485.1.23681 XP_002827486.1.23681 XP_003805915.1.60992 XP_004041603.1.27298 XP_004041604.1.27298 XP_005584468.1.63531 XP_008010625.1.81039 XP_008010626.1.81039 XP_009249943.1.23681 XP_010352265.1.97406 XP_011718165.1.29376 XP_011718174.1.29376 XP_011718182.1.29376 XP_011795480.1.43180 XP_011841297.1.47321 XP_014975332.1.72884 XP_014975333.1.72884 XP_015294089.1.63531 XP_016787172.1.37143 XP_016787173.1.37143 XP_016880492.1.92137 XP_016880493.1.92137 XP_017731533.1.44346 ENSP00000345297 ENSP00000377231 ENSP00000432925 ENSP00000437180 gi|115529449|ref|NP_001070152.1| gi|115529451|ref|NP_001070151.1| ENSP00000345297 ENSP00000377231 ENSP00000432925 ENSP00000437180 ENSPPYP00000023584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]