SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023846 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023846
Domain Number 1 Region: 166-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 108-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 428-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 331-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000848
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023846   Gene: ENSPPYG00000029739   Transcript: ENSPPYT00000033111
Sequence length 488
Comment pep:novel chromosome:PPYG2:17:5147227:5148690:-1 gene:ENSPPYG00000029739 transcript:ENSPPYT00000033111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEWKSKMEISEEKKSARAASKKLQRQITQECELVETSNSEDRLLKHWVSPLKDAVRHLP
SQESSIREMHIIPKKAIVGEIGHGCNEGEKILSAGESSNRYEVSGQNFKQRSGLTEHQKI
HNINKTYECKECGKTFNRSSNLIIHQRIHTGNKPYVCNECGKDSNQSSNLTIHQRIHTGK
KPYICHECGKDFNQSSNLVRHKQIHSGGNPYECKECGKAFKGSSNLVLHQRIHSRGKPYL
CNKCGKAFSQSTDLIIHHRIHTGEKPYECYDCGQMFSQSSHLVTHQRIHTGEKPLKCNEC
EKAFRQHSHLTEHQRLHSGEKPYECHKRGKTFSGHTAFLKHQRLHAGEKLEECEKTFSKD
EELREEQRIHQEEKAYWCNQCGRNFQGSSDLIRHRVTHIGEKPYECKECGKTFNQSSDLV
RHHRIHSGEKPCVCSKCGKSFRGSSDLIRHHRVHTGEKPYECSECGKPFSQRSHLLTHQK
IHTGEKPY
Download sequence
Identical sequences K7ETH5
ENSPPYP00000023846 ENSPPYP00000023846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]