SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023950 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023950
Domain Number 1 Region: 432-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 190-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000724
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 389-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000125
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 4 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000745
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 150-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000691
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023950   Gene: ENSPPYG00000012548   Transcript: ENSPPYT00000033214
Sequence length 573
Comment pep:known_by_projection chromosome:PPYG2:2a:84747352:84753032:1 gene:ENSPPYG00000012548 transcript:ENSPPYT00000033214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRKQSHPQPVKCEGVKVDTEDSLDEGPGALVLESDLLLGQDLEFEEEEEEEEGDGNSD
QLMGFERDSEGDSLGARPGLPYGLSDDESGGGRALSAESEVEEPAKGPGEARGERPGPAC
QLCGGPTGEGPCCGAGGPGGGPLLPPRLLYSCRLCTFVSHYSSHLKRHMQTHSGEKPFRC
GRCPYASAQLVNLTRHTRTHTGEKPYRCPHCPFACSSLGNLRRHQRTHAGPPTPPCPTCG
FRCCAPRPARPPSPTEQEGAVPRRPEGKTHQGPKILGTWVAGPRNAWIGFIAQVFVPTDA
LLLPDLSLHVPPGGASFLPDCGQLRGEGEGLCGTGSEPLPELLFPWTCRGCGQELEEGEG
SRLGAAMCGRCMRGEAGGGASGGPQGPSDKGFACSLCPFATHYPNHLARHMKTHSGEKPF
RCARCPYASAHLDNLKRHQRVHTGEKPYKCPLCPYACGNLANLKRHGRIHSGDKPFRCSL
CNYSCNQSMNLKRHMLRHTGEKPFRCATCAYTTGHWDNYKRHQKVHGHGGAGGPGLSASE
GWAPPHSPPSVLSSRGPPALGTAGSRAVHTDSP
Download sequence
Identical sequences K7ETS7
ENSPPYP00000023950 ENSPPYP00000023950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]