SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000023975 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000023975
Domain Number 1 Region: 25-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-25
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 266-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 218-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000631
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000023975   Gene: ENSPPYG00000029845   Transcript: ENSPPYT00000033241
Sequence length 443
Comment pep:known_by_projection chromosome:PPYG2:7:27869959:27920496:-1 gene:ENSPPYG00000029845 transcript:ENSPPYT00000033241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASQNAVFSQEGNMEEKEMNDGSQMVRSQESLTFQDVAVDFTREEWDQLYPAQKNLYRDV
MLENYRNLVALGYQLYKPEVIAQLELEEEWVIERDSLLDTHLDGENRPEIKKSTTSQNIS
DENQTHEMIMERLAGDSFWYSILGGLWDFDYHPEFNQENHKRYLGQVTLTHKKITQERSL
ECNKFAENCNLNSNLMQQRIPSIKIPLNSDIQGNSIKHNSDLIYYQGNYVRETPYKYSEC
GKIFNQHILLTDHIHTAEKPSECGKAFSYTSSLTQPQMVLTGEKPYKCDECGKRFSQRIH
LIQHQRIHTGEKPFICNGCGKAFRQHSSFTQHLRIHTGEKPYKCNQCGKAFSRITSLTEH
HRLHTGEKPYECGFCGKAFSQRTHLNQHERTHTGEKPYKCNECGKAFSQSAHLNQHRKIH
TREKLCEYKCEQTVRHSPSLSST
Download sequence
Identical sequences K7ETV2
ENSPPYP00000023975 ENSPPYP00000023975 XP_002817971.2.23681 XP_009241055.1.23681 XP_009241056.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]