SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024021 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024021
Domain Number 1 Region: 770-997
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 366-542
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.32e-57
Family Regulator of G-protein signaling, RGS 0.0000000146
Further Details:      
 
Domain Number 3 Region: 1001-1135
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-44
Family Pleckstrin-homology domain (PH domain) 0.000000272
Further Details:      
 
Domain Number 4 Region: 51-137
Classification Level Classification E-value
Superfamily PDZ domain-like 8.28e-21
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024021   Gene: ENSPPYG00000000695   Transcript: ENSPPYT00000033285
Sequence length 1578
Comment pep:known_by_projection chromosome:PPYG2:1:94456051:94566320:1 gene:ENSPPYG00000000695 transcript:ENSPPYT00000033285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRSASKKQSHLSSPIAAWLSSLSSLGDSTPERKSPSHHRQPSDASETTGLV
QRCVIIQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLE
VVKLIKSGAYVALTLLGSSPSSVGISGLQQDPFPAGAPRITSVIPSPPPPPPLPPPQRIT
GPKPLQDPEVQKHATQILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQL
KIQQETGGSVDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSVL
SDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFN
NESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRSLGKDI
WNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRT
LGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAG
IRLREARPSNTTEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPK
SSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSR
SEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSL
ENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDV
VAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPE
LIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIK
TKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHE
KLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKNLDLTTR
KMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTTVGSSDSKQTFSP
VLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRH
PGAAPMPVHPPPPGPQEPVHQGPIPSRVELDDSDVFHGEPEPEELPGGTGSQQRIQGKHP
VLLEDPEQEDSAEKVELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALED
VENLRHLILWSLLPGHTMETQAAQEPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGEGDN
IQLAGLEGERPEQEDMGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVR
KAEVAGSKVVPALPESGQSEPGPPEVEGGTKATGNCFYVSMPSGPLDSSTDHSGAPTSPP
QPDSLPAGQTEPQPQLQGGNGDPRRPSHSPPSLALRDVGMIFRTIEQLTLKLNRLKDMEL
AHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPAKEPLASDSRNSHELGPCPEDG
SDAPLEDSAADAAASPGP
Download sequence
Identical sequences K7ETZ8
ENSPPYP00000024021 ENSPPYP00000024021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]