SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024087 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024087
Domain Number 1 Region: 260-508
Classification Level Classification E-value
Superfamily SIS domain 3.06e-19
Family mono-SIS domain 0.0064
Further Details:      
 
Domain Number 2 Region: 9-258
Classification Level Classification E-value
Superfamily SIS domain 0.00000000779
Family mono-SIS domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024087   Gene: ENSPPYG00000012542   Transcript: ENSPPYT00000033350
Sequence length 605
Comment pep:known_by_projection chromosome:PPYG2:2a:84601827:84632049:-1 gene:ENSPPYG00000012542 transcript:ENSPPYT00000033350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGYEAAVPITEKSNPLTQELDKADAENIVRLLGQCDAEIFQEEGQALPTYQRLYSESIL
TTMVQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSFNQLMKGLGQKPLYTYLIAG
GDRSVVASREGTEDSALHGIEELKKVAAGKKRVIVIGISVGLSAPFVAGQMDYCMNNTAV
FLPVLVGFNPVSMARNDPIEDWSSTFRQVAERMQKIQEKQKAFVLNPAIGPEGLSGSSRM
KGGSATKILLETLLLAAHKTVDQGIAASQRCLLEILRTFERAHQVTYSQSPKIATLMKSV
STSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRDVRGFLIGDHSDMFNQKAELTN
QGPQFTFSQEDLLTSILPSLTEIDTVVFIFTLDDNLMEVQTIVEQVKEKTSHIQALAHST
VGQTLPIRLKKLFPSIISITWPLLFFEYEGNFIQKFQRELSTKWVLNTVSTGAHVLLGKI
LQNHMLDLRISNSKLFWRALAMLQRFSGQSKARCIESLLRAIHFPQPLSDDIRAAPISCH
VQVAHEKDQVIPIALLSLLFRCSITEAQAHLAAAPSVCEAVRSALAGPGQKRTADPLEIL
EPDVQ
Download sequence
Identical sequences K7EU63
ENSPPYP00000024087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]