SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024137 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024137
Domain Number 1 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 3-60
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.89e-23
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 3 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.64e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 4 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 147-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000539
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024137   Gene: ENSPPYG00000029915   Transcript: ENSPPYT00000033400
Sequence length 385
Comment pep:novel chromosome:PPYG2:19:37792548:37823292:1 gene:ENSPPYG00000029915 transcript:ENSPPYT00000033400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEGLKFKDVVIYFSQKEWECLHSAQKDLYRDVMLENYGNLVLLGLSDTKPNVISLLEQK
KEPWMIKRKETKEWCPDWEFGRETKNLSPKENIYEIRSPQQEKARVIREIRCQVERQQGH
QEGHFRQAVIPFTSVQCTAHREYQWLHTGEKCCECRKCKNAFRCQLCPIQHEIIHNKEKE
PECRECRKIFNSGSDLIKYQTLHESKKHSENNKCAFNRDSGITQPQSINTGNKPHICKEC
GKGFHSSSQISQHQRMHLGEKPYKCRECGKAFPSTAQLNLHQRIHTDEKYYECKECGKAF
TRPSHLFRHQRIHTGEKPHKCKECGKAFRYDTQLSLHQIIHTGERRYECRECGKVYSCAS
QLSLHQRIHTGEKPHECKECGKAFL
Download sequence
Identical sequences K7EUB3
ENSPPYP00000024137 ENSPPYP00000024137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]