SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024354 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024354
Domain Number 1 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 2 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.93e-24
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 222-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000262
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 482-530
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000168
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSPPYP00000024354
Domain Number - Region: 166-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000223
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024354   Gene: ENSPPYG00000029671   Transcript: ENSPPYT00000033618
Sequence length 540
Comment pep:known_by_projection chromosome:PPYG2:19:37470561:37497832:-1 gene:ENSPPYG00000029671 transcript:ENSPPYT00000033618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQ
GKEPWMVVREETGRWCPDLASRDEPQKLSPKRDIYETELSQWVNMEEFRSHSPERSIFRD
IWEGNCHFEQHQGQEEGYFKQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSY
HLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKH
LRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLH
TGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEK
PYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYEC
KECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECG
KAFSYHSSFSHHQRIHSGKKPYQRGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLGS
Download sequence
Identical sequences K7EUX7
ENSPPYP00000024354 ENSPPYP00000024354 XP_009230787.1.23681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]