SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPPYP00000024637 from Pongo abelii 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPPYP00000024637
Domain Number 1 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.58e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 241-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 493-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 5 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.96e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 353-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-22
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 8 Region: 437-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 646-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.3e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 590-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000985
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 11 Region: 153-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000304
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 399-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000142
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPPYP00000024637   Gene: ENSPPYG00000029591   Transcript: ENSPPYT00000033900
Sequence length 707
Comment pep:known_by_projection chromosome:PPYG2:19:45243650:45367562:1 gene:ENSPPYG00000029591 transcript:ENSPPYT00000033900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYRDVMLENFRNLLSMGHQPFHQDTFHFL
KEETFWMMGTATQREGNSGDKIQTEMETVSEAGTNQEWSCQQIWEKIASDLTRSQDLVIN
SSQFSKEGDFPCQTEAGLSVIHTRQKSSQGNGYKQSFSDVSLFDFHQQLHSGEKSHTCDE
CGKSFCYISALRIHQRVHMGEKCYKCDVCGKEFSHSSHLQTHQRVHTGEKPFKCVECGKG
FSRRSALNVHCKLHTGEKPYNCEECGKAFIHDSQLQEHQRIHTGEKPFKCDVCGKSFCGR
SRLNRHSMVHTGEKPFRCDTCGKSFRQRSALNSHHMIHTGEKPYKCEECGKGFICRRDLY
THHMVHTGEKPYNCKECGKSFRWASCLLKHQRVHSGEKPFKCEECGKGFYTNSQCYSHQR
SHSGEKPYKCVECGKGYKRRLDLDFHQRVHTGEKLYNCKECGKSFSRAPCLLKHERLHSG
EKPFQCEECGKRFTQNSHLHSHQRVHTGEKPYKCEKCGKGYNSKFNLDMHQKVHTGERPY
NCKECGKSFGWASCLLKHQRLHSGEKPFKCEECGKRFTQNSQLHSHQRVHTGEKPYKCDE
CGKGFSWSSTRLTHQRRHSRETPLKCEEHGKKIVQNSFSKVQEKVHSVEKPYKCEDCGKG
YNRRLNLDMHQRVHMGEKTWKCRECDMCFSQASSLQLHQNVHIGEKP
Download sequence
Identical sequences K7EVQ1
ENSPPYP00000024637 ENSPPYP00000024637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]