SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85060205|ref|YP_455907.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85060205|ref|YP_455907.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily HAD-like 5.82e-41
Family YihX-like 0.000000685
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|85060205|ref|YP_455907.1|
Sequence length 195
Comment phosphatase [Sodalis glossinidius str. 'morsitans']
Sequence
MLYIFDLGNVVIDIDFNRVLGVWSNFSRVPLAILQKEFVMGEAFEQHERGDITDEAFAAK
ICGELGIALSFEQFTAGWQAVFVGLRPEMVAILTRLREQGHRVVILSNTNRLHCDYWPSQ
YPEVQACVDKLYLSQDLGMRKPDPAIYRYVLAQEGATADGAVFFDDNADNIAAAREVGIR
SMHVTDREVVPAFFA
Download sequence
Identical sequences Q2NQS3
343509.SG2227 WP_011412038.1.28452 gi|85060205|ref|YP_455907.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]