SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|85060292|ref|YP_455994.1| from Sodalis glossinidius str. 'morsitans'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|85060292|ref|YP_455994.1|
Domain Number 1 Region: 5-217
Classification Level Classification E-value
Superfamily HAD-like 7.87e-42
Family YihX-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|85060292|ref|YP_455994.1|
Sequence length 226
Comment hypothetical protein SG2314 [Sodalis glossinidius str. 'morsitans']
Sequence
MSTVIDWRHIDTVILDMDGTLLDLAFDRDFWLARVPAALTQRRGITPAEASALIDREYHS
VRHTLNWYCFDYWSRRLTLDIAAMNAEFGHTVRLRDDTLPLLSALRQHGRRSILLTNAHP
DGLAVKMRHTGLGQHLDLLLSTHTFGYPKEDQHLWQRVQTHTGFDPARTLFIDDSEPILD
AASRFGIRYCLGVSNPDSGVAPQTFRRHSSLNDYRTLLPALAGMMC
Download sequence
Identical sequences Q2NQI6
gi|85060292|ref|YP_455994.1| WP_011412122.1.28452 343509.SG2314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]