SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000001282 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000001282
Domain Number 1 Region: 1-51
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.49e-20
Family Calponin-homology domain, CH-domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000001282   Gene: ENSOANG00000000826   Transcript: ENSOANT00000001283
Sequence length 51
Comment pep:novel ultracontig:OANA5:Ultra164:136238:136390:1 gene:ENSOANG00000000826 transcript:ENSOANT00000001283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEREVVQKKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEML
Download sequence
Identical sequences F6PKG2
ENSOANP00000001282 ENSOANP00000001282 9258.ENSOANP00000001282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]