SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000002011 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000002011
Domain Number 1 Region: 107-203
Classification Level Classification E-value
Superfamily PH domain-like 8.92e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000002011
Domain Number - Region: 454-517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00266
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000002011   Gene: ENSOANG00000001265   Transcript: ENSOANT00000002012
Sequence length 2039
Comment pep:novel chromosome:OANA5:2:23088635:23148725:-1 gene:ENSOANG00000001265 transcript:ENSOANT00000002012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EESTMNGDRIDCGRKARVESGYFSLEKTKQDSKAEEQQLPPPSPPSPSAPNNRRSQVIEK
FEALDIEKAEHMETNSSAGPAQSGETRQGRSEKRVFPRKRPDLLNFKKGWLTKQYEDGQW
KKHWFVLADQSLRYYRDSVAEEAADLDGEIDLSTCYDVTEYPVQRNYGFQIHTKEGEFTL
SAMTSGIRRNWIQTIMKHVHPTTAPDVTSSLPEEKNKSSSSSSSSPAFEACPKPSEKQDQ
DQGDLDPEQKRSRARERRREGRSKTFDWAEFRPIQQALAQERASAAEAPSAREPGGLDTD
LGELERERARRREERRKRFEMIDSVDGPSGEDSGSRMEVDRSPVSPVAPETKPQNVHVEI
EQRWHQVETTPREEKQVPIAPLHLSSDDGPDRLPAQEITSLLEKELEQSQKEASDLLEQN
RVLQDQLKVALGREQSAREGYVLQTEVTTSPSCAWLRLHKVNQDLQSELEAQCQRQELIN
QQIQSLKRSYGEAKDVIRHHEAEIQSLQARLSNAAAELAIKEQTLAKLKSDLKMEKAKVR
EQLEEWQHSETTLSSQLRASEQKLKSAEALLLEKTQELRDLEVQQALQRDHQKEVQRLQE
RIADLSQQLGASERAQALMEEKLQKNYELLLDSCEKEKQALIQNLREAEEKASDYEDQLQ
DHEQQMEILQKEKLNATFEGSEMVHQLEEELQVKEASVQKLAEHIQSLQGERDQIRTRFQ
ELLDQVARSDGEVAELREKLEAREADYLHLEGTHRRVSDRFRDVHAALKGKEEELQRIKA
LHEKIVAKKDQDLNEAMVKMVALGSSLEETEIRLQAKEGVLRRGANAHPGGPDDECPTLD
ADGEGVALLGQPEQAQGGPPATHSPPQVNEGLEASQGEVSETPGLEAGDVVTLSESAEPH
DREGLQKAAPKCEGGTPGTKRQRIRFSSIQCQKYIHPDGSEKNWASSTSSDTSQDRSLSE
ESMSSEPALTGLSAGTGAPEAYLSIIHSLETKLYVTEEKLKDVTMKLENQQGQNQEALIA
LHQQWAGTESQLRDQLQTSLSQVAALASQLEDERKERQTVMKKHVGELGDFRVKNSRALS
CLEACREQLRSLLKADREKEGDLGLATLSSVEIILSDAVRVLRQIPSWPGEAREESLPAG
DKVTPQFPGLTHQDQLKLLAEKTSFEASLINQIAESLTDASSALSRTLQEIDLSTKVSLE
PTSGSRTAGTSAEALCKKLLLESQFWSQVEDLRKQLGGLGSEGGGGNQADAGPPCFPRDS
ISALADATLVKAELGFAVQKLRESFHDRLQTLEDNLRGTKTALEQYKGMLGEIIRAHGTP
SLESVVRQISETLEPQAGIERGGLTEEDGKRFEPEPAPGPAEGLDLPRAPDQGEEEETLV
SIQEQLAQQLKEKASVLEEIAASLASLPPGEPPGDQREVLEASQGVSDLTSLGGLSRCSS
LLVRDAITQAQVCYAGCRIRLQYEKELRFYKDSWEKAGASCQERARAVAALRLEYEELLR
KQKSEYLQVIAIVERENADLKARVAQLARQQRCLEEAESKHNESIFALQGRYEEEMRSVV
EQLSRTENTLRAEKTRVLSQLDASVKDKQDMERYHGEQMQTLEDKFQLKIRELQLIHEEE
LRTLQEHYTQNLRCLQETLNYYQRQHPGGLPALEHRSWPSARPDGAGQMTEVEADSTTGL
RERIQELEAQMNVMREELEHKDLEGNASTLREKYQKDFENLKATCERGFAAMEETHQKKI
EDLQRQHQRELEKLREEKDRLLAEETAATISAIEAMKNAHREEMERELEKTQRSQISSVN
SDIEALRRQYLEELQSVQRELEVLSEQYSQKCLENAHLAQALEAERQALRQCQRENQELN
AHNQELNNRLAAEITRLRTLLMGEGGGEAAGSPLTQGKDAYELEVLLRVKESEIQYLKQE
ISSLKDELQTALRDKKYASDKYKDIYTELSIVKAKADCDISRLKEQLKAATEALGEKSPE
NTTVSGYDIMKSKSNPDFLKKDRSSVSRQLRNIRSKSLKEGLTVQERLKLFESRDLKKN
Download sequence
Identical sequences F7G8Y9
ENSOANP00000002011 ENSOANP00000002011 9258.ENSOANP00000002011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]