SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000002127 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000002127
Domain Number 1 Region: 1078-1134
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 182-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 3 Region: 994-1050
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 3-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-19
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 5 Region: 826-882
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.91e-19
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 686-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 7 Region: 630-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 8 Region: 518-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 9 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-18
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 10 Region: 294-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.7e-18
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 11 Region: 742-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.85e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 12 Region: 882-938
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-17
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 13 Region: 574-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.29e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 14 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.63e-17
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 15 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 16 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 17 Region: 938-994
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 18 Region: 126-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000981
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 19 Region: 788-820
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000192
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 20 Region: 1040-1072
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000274
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000002127   Gene: ENSOANG00000001330   Transcript: ENSOANT00000002128
Sequence length 1171
Comment pep:known_by_projection supercontig:OANA5:Contig3143:5383:13391:1 gene:ENSOANG00000001330 transcript:ENSOANT00000002128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQPVLFEDVAVSFSREEWECLDPSQKVLYQDVMGENYRNVVLLGKELGQPGFLGCFPGSV
SQWKASRGRETLQVPQVWKRIQSELQPVHAPENPQRRAVLSMSLWEKLQPEIKANPTPED
SHRKGFKEEGNLVQHRRTHVGEKPNKRPRCGRDFSHNSNSSKHQCDHTGEKPHKCPRCGE
GFSQTSNLSEHQCINTGEKPYKCPSCGKAFSYGSNLSKHQCIHTGEKPYKCPRCGKDFSH
NSDLSKHQCAHSGEKRHKCPSCGEGFSHNSDLSKHQCAHIGEKPHKCPTCGKGFSETSKL
STHQCVHTGEKPYKCHRCGEGFSCSSNLSKHQCIHTGGKPYKCPRCGEGFSHSSNLSKHQ
CSDTGEKSYKCPRCGEAFSCGSNLSEHQCVDPGEKPYKCPSCGEGFGHNSNLSKHQCSDT
GEKPYKCPRCGEAFSCGSNLSEHQCVDPGEKPYKCPSCGEGFSHNSDLSKHQCAHNGEKP
HKCPTCGKGFSQTSKLSTHQCVHTGEKPYKCHSCGEGFSHNSDLSKHQCAHIGEKPHKCP
RCGKGFSQTSKLSTHQCIHTGEKPYKCHRCGEGFSCSSNLSKHQCIHTGGKPYKCPRWGE
AFSCGSNLSEHQCVDPGEKPYKCPSCGEGFSHNSDLSKHQCAHNGEKPHKCPTCGKGFSQ
TSKLSTHQCIHTGEKPYKCHSCGEGFSHNSDLSKHQCAHNGEKPHKCPTCGKGFSQTSKL
STHQCIHTGEKPYKCHRCGEGFSCSSNLSKHQCIHTGGKPYKCPRCGEAFSCGSNLSEHQ
CVDPGEKPYKCPSCGEGFSHNSDLSKHQCAHNGEKPHKCPTCGKGFSQTSKLSTHQCVHT
GEKPYKCHRCGEGFSCSSNLSKHQCIHTGGKPYKCPRCGEGFSCGSNLSEHQCVDPGEKP
YKCPSCGEGFSHNSDLSKHQCAHIGEKPHKCPTCGKGFSETFKLSTHQCVRTGEKPYKCH
RCGEGFSCSSNLSKHQCIHTGGKPYKCPRCGEGFSHSSNLSKHQCIDTGEKPYKCPTCGE
GFSQTSNLSEHQSVDTGEKPYKCPSCGEGFSYSSDLSKHQCVRTGEKPHKCPRCGEQFSH
SSNLSKHQWVHHGEKPYKCPRCGKGFNQSSNLSKHQCVHHGEKPYKCSRCGKGFNQSSNL
SKHPCIHTGENLQIPQMPRHQRIHTGEALYS
Download sequence
Identical sequences F7F378
ENSOANP00000002127 9258.ENSOANP00000002127 ENSOANP00000002127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]