SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000002963 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000002963
Domain Number 1 Region: 1710-1955
Classification Level Classification E-value
Superfamily Plakin repeat 4.45e-68
Family Plakin repeat 0.00000726
Further Details:      
 
Domain Number 2 Region: 161-298
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000011
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 1620-1731
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000139
Family Plakin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000002963
Domain Number - Region: 708-790,818-844
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0194
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000002963   Gene: ENSOANG00000001866   Transcript: ENSOANT00000002964
Sequence length 1973
Comment pep:novel supercontig:OANA5:Contig2834:59375:72304:-1 gene:ENSOANG00000001866 transcript:ENSOANT00000002964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RASTQELALLISRMQANADQVERDILESQKRLQLDRASSEQCQALQYQQETGRDLKEAET
LLKDLFLDVDKAKRMKHPQAAEIEKDIKQLHERVTQECAEYRALYEKVVLPPGVGTKVDW
SRLLEQKQKQVCEGQFGPGMPELEQQIAEHNVLQKEIEAYGQTLLNLSGPDAATIKNQYR
DLLKAASWRGQSLGSLYTHLQGCTRQLNALADQQRRILQQDWSDQMADPAGLRREYEHFK
SHELLAQEQCVNQLEDDGERMIELNHPAVGPIQVHQEALKTEWQNFLNLCICQESQLQRV
EDYRRFQDDADSADQVLRKLSSDLDTKLSPDGRGTPGTPSDLGRPLESEEKQLIMAEKTV
QDLQRRCQDIAPLPLRRTPPSQPLRVDAICDWDAGDVQLLRGETYTLKDNSHPETWLVQG
PGGESKPAPAACFSIPGPNPEAVARARRLEAELRALKQKKAAVESSLGARGSASPAKPIQ
PTQQDPAAGSGRIDPHAQKVLTRLTGLEKDLTQTEQEILGRLRAPLSRHAPVEDLTARLR
GQEATARQLQGLGADKEAAQRECEALLSSQLPVALNNVKNKFSDVQALCALYGEKAKASL
ELEQQIQKSDQLIQTFEAALGQEAPLAAGPGALQDRAGELQRQRRELQAQQACVLGLHRG
LKATEQGCGALQNNFREFCQDLPRQRQRVQRLTDRYHAVADQLDTQEKTIQDASLTYQQF
KNSNENLTSWLAHLPCNSARPNDGPSQVNYKLQAQKRLVQEIQNKEEDRNTVLRLSRDLQ
GALQDYELQTDKYRCSLDPTLTVPAPKKPSISPLQESIQAQEKAVVQRFTEVAAQNRQQL
SQLEFARKVMEKKESSEDVQEASEGSLGAERPVGAGTEAVAATLKGQLEKERQRVAQVQQ
ELEEQRAQLLLLKTQRPVERLEEKEVVEVYRDPGLESGLSEMRAQLEAEGKERARVRAEL
EAAAREVARLEGQKRPSQPELLNPREGHPGGSGTPGWRAEAAQLRAAAQQLREEGAAGTQ
LERLREELLTLERRPAPAVQEKVVVKEVIKLEKDPEMVRAAQALQRQLEEDGCRRQEAEE
AALRLRDRIRELEQLIGAVEPKVVVKEVKKVEQDPGLQRESARLRSLLDEERGRNAALCG
ELQDLRARLSLAEQRKPRVEVKERVHETFRVDPETEREIARLQREVRETAAKRSAVEKEV
ERVLPELSALRARQPKLEYQEVVQEVVKHEKSPEVLREIDRLKAQLNELVNAHGRAQEQL
IRLGGERDEWKRERSKVETKTVTKEVVRHENDPVLEKEAERLRLEVQGAAQKRRAAEAAL
FEVQSRLLLLERRRPEERVVVQEVVVTRRDPQLQEEHSRLSRGLDEAAGQRRLLEREAQQ
LRAAVAEDEARLTFQEERNKRLAAEKELRRLGLRLRELRERPPPVAPEKVITEEVVQLER
DPEVERAVGALRRELEAEKQHGAELGRERVGLQGRIEALRQTKGQEKTVYKEVVRVERDR
ALEGERARVWEQLSQERAARQGREGTVRQLQGRVERAEAQGRTWAREEADLQRARQQASQ
ERAQLERETRELERQRQQAVQELREEARLADRKSESERQRKALCGQELARLEVAILAEKD
QIYEKERTLRDLQAKINREELGQETQTCETNLSTTISVLDPDTGGDLSPCEAYQRGIVDR
AQYAQLRALECDWEEVTTSALGGEASVLLDKKSGRRYSIQEALRCRRVTEDELRLYRSGR
LPVAEFALLVSGEAGPRFSPGPGGDAFPIAGVYDPAADSKCGIRAAMARGLLDPITGQKL
LEAQAATGGIVDLLTRERFSVHKAMERGLVDDTSTQRLLNAQKAFTGIEDPVTKKRLAVG
EAVQKGWMPRESALPHLQVQHLTGGLIDPKRAGRIPVSQALQMGMISGELAELLQDESGY
EKELTDPVSKERLSYKEAMGRCRQDPLTGLLLLPAAPGGCLPCCSPAPSRRLL
Download sequence
Identical sequences F7F6U6
9258.ENSOANP00000002963 ENSOANP00000002963 ENSOANP00000002963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]