SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000003428 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000003428
Domain Number 1 Region: 39-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.24e-40
Family SCAN domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 488-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 449-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 543-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 226-283
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.19e-16
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 
Domain Number 6 Region: 585-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000561
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000003428   Gene: ENSOANG00000002158   Transcript: ENSOANT00000003429
Sequence length 618
Comment pep:known_by_projection ultracontig:OANA5:Ultra521:118491:143220:1 gene:ENSOANG00000002158 transcript:ENSOANT00000003429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVGLPVQSPLEQEEILIVKVEEDFSWGEETSPQGDDPSPETFRQLFRLFCYQEVAGP
REALSRLRELCCRWLRPEVRTKEQILELLVLEQFLTILPGDIQTWVREQDPESGEEVVVL
VEGLHREPRRQRQRVTVRVQGQEVVAEEPAPRGGPREARRFQVEPLLQEEEGAQDPHPGP
LPQQQQLNHRPRREPQLRPKRVMPPPWIPAPGSPTDEETTTTLLSAWSQTPVMLEEVAVY
LSQEEWERLDPAQRDRYRDVLQDNYGNRAFRGLMIPRRQLFDPLREEQLPPLPSTPVSYC
LPQSLLQEVIEMSMWQGDGLALGKGRAFLIIGLSEDLPLIVEWEMERNNQYFGASLAGIA
EEFKIETVRMETKEGNPKQASSMKVGLHRTLSGKSRGDVLQDPGQGQVCENGSGWQRDHL
PGERHGPTPVEERDVGKLLGHWRPCTVEKPYKCLECGKSFNKSSHLIKHQRTHTGEKPYK
CLVCGKGFSDRSNFSTHQRIHTGEKPYKCNECGKCFSQSSSLVIHRRTHTGERPYKCGEC
GKSFNNSSHFSAHRRTHTGEKPYPCHDCGKSFRRGTDLNKHQRTHTGERPYKCHCGKSFT
RKHQLITHQGIHTGEKAF
Download sequence
Identical sequences F7AMF4
ENSOANP00000003428 ENSOANP00000003428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]