SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000004955 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000004955
Domain Number 1 Region: 10-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.75e-25
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 309-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 254-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 198-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 159-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000004955   Gene: ENSOANG00000003124   Transcript: ENSOANT00000004956
Sequence length 379
Comment pep:novel supercontig:OANA5:Contig12561:10178:13790:-1 gene:ENSOANG00000003124 transcript:ENSOANT00000004956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRSPGFPPSLQMAVTFEDVAVYLSREEWERLGSAQRSLYRDVMQENYWNLVSLGLPILKP
EVIDRLEQGEEPWSKDYLSTVLARGIRGGQANGETRRDAATSQRNCRPGPGTLGLTCSSV
WPGRKLEKQRGKRQETPTPHTWGLGKLSVPPSKASAEEKAYICSECGKSFTQWSNLTKHQ
KIHSGEKLYKCVDCGKRFSYSYLYIQHLRTHTGEKPYKCPECGKNFSENSNLIRHKKTHR
GEKPYTCTECGKRFTVNSSLLTHRRIHTGEKPYKCSQCGKNFTHNTTLIEHQRTHTGEKP
YKCSDCEKSFIQRSDLIKHRRTHTGKKPYKCPQCGKNFSLSSNLLRHQRLHTAEKPYKCP
ECGDGFGQRAEVADHIETH
Download sequence
Identical sequences F6U4Y3
ENSOANP00000004955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]