SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005072 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005072
Domain Number 1 Region: 49-198
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.19e-54
Family Calponin-homology domain, CH-domain 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005072   Gene: ENSOANG00000003195   Transcript: ENSOANT00000005073
Sequence length 210
Comment pep:known_by_projection ultracontig:OANA5:Ultra745:1595:4994:-1 gene:ENSOANG00000003195 transcript:ENSOANT00000005073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVPGPAEVDNMEMPAVPGSNNNNGPRWESPERGWERERERDSLFECSRIRALADEREA
VQKKTFTKWVNSHLARVSCRIGDLYSDLRDGYVLTQLLEVLSGEPLPRPTRGRMRIHSLE
NVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIILRFQIQVIKIEAEDNRETRS
AKDALLLWCQMKTAGYDLAINPSVVFIECL
Download sequence
Identical sequences F6YVY4
ENSOANP00000005072 ENSOANP00000005072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]