SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005189 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000005189
Domain Number - Region: 30-86
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.089
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005189   Gene: ENSOANG00000003269   Transcript: ENSOANT00000005190
Sequence length 1130
Comment pep:known_by_projection ultracontig:OANA5:Ultra371:417650:468490:-1 gene:ENSOANG00000003269 transcript:ENSOANT00000005190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQEPRIYFLLFFLSHAVAVVKAPNSRQDLPPLLQKMADDIIDGRYLNALLDLIQFQSSN
VWTAELSRKVMSFFQSQNVAFTISSLQVAMKSYLEHLLYQPQQLLADFRQTDHQQFQTAM
KSLFANKKGHLELEDIVIDLEEIRERVLQTPGGNRTLFLITLEKCFQVLSSFECVDILSQ
VLKVSSVSYLQPEIVRRLPSDLQEDSFKNLSAVFKDVYDKTSAHTQRALYYWMTEILQKS
SNSSDDSISWVSAENLWILGRYMVHLPIEEIMKISPSEIGLFISYDNATKQLDTVYDITP
ELAQAFLERINSSSFDMRNTSTIHRQGEEVCVFRSFEDRLGLLVCFYDDLEELDATVAQV
LLHQMIKCNRLRGFQADVQKLKAELLDVAMENQTLNDTLGSLSDAVVGLTCSQLESLAPE
AVQNAISTLNQVSGWAKGQIIILSGKYLAHEKVISFYNISQMGALLAGISTQTFYNMDSK
ELSNVVKGTISQHASDLSLAQQQGILSKMIESGDISSAVVDEQGVFFKELSLSDLWKESG
FNSSVVKEKELRRSQAMFLYEFLSKMTGKPDELLRVGQLVKGITCQQIESMSTDSFLSHF
KCFESHLQLLSPYQVNCLAWKYWKVSSSSLPPYLLLALPAHYLDLISVSQCIPFLISIGK
IQLDALVLDSYKKNSVLRKVQLCLNDSIADDYDVDIVGNLLCHLPSTMIHHGISPRAIST
AIHQFKLCRSLSPEQKTHIKYRLLELHGPPENWTMETTKDIGAFLVLFSGEELNVISSKF
PNIIQQVASKMRGTHLPEEFLWAVFESVRNTSSYVQASVVRADCLGITAPSSEDILKLAE
ANACWSPQELLCMREDTFIKNVELLGTVLSFSHSQLTALKEKAKQAWDNPPYWKNHQIVS
LGRIALALNESEIEELDLKSIDTVAALSQQKEWTPEQSRSILRGFLEDSDQKVPELKSFD
LVGLGMNLCALKAAEIHLLSTFSCSAVAARIGTLLCSAPVLEEFKKKAEDVFGHPTKWSS
SVVQEIGTIAAGLTKEELKVLDKDLMPYFQPTAIKCIPDEIFKELSPEQMANLGPENAAS
VTGSQRRRLNRLQLQSLQLALDGARTGFQDDASVSESTTRSISGPASNCE
Download sequence
Identical sequences F6RQU7
ENSOANP00000005189 ENSOANP00000005189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]