SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005890 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005890
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000104
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005890   Gene: ENSOANG00000003716   Transcript: ENSOANT00000005892
Sequence length 67
Comment pep:known_by_projection ultracontig:OANA5:Ultra613:10460:10660:1 gene:ENSOANG00000003716 transcript:ENSOANT00000005892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSFRSDVQRVAKRVDAVLAAGEGLMQRSDPRDAVALEEALRALSGQCQTVFGRLAQLQGR
LVSHSLV
Download sequence
Identical sequences F7DNZ6
ENSOANP00000005890 ENSOANP00000005890 9258.ENSOANP00000005890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]