SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000005947 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000005947
Domain Number 1 Region: 20-100
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000889
Family CRAL/TRIO domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000005947   Gene: ENSOANG00000003749   Transcript: ENSOANT00000005949
Sequence length 103
Comment pep:known_by_projection supercontig:OANA5:Contig11297:15060:28735:1 gene:ENSOANG00000003749 transcript:ENSOANT00000005949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLEAASIGFIIVIDRRRDKWSSVKASLTRIAGAFPGNLQLVFVLRPSRFIQRTIADIGIK
LYRDDFKMKVPIIMLNSVSDLHGYIDKTQLTRDLGGTLEYGHS
Download sequence
Identical sequences F7CTR4
9258.ENSOANP00000005947 ENSOANP00000005947 ENSOANP00000005947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]