SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006268 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006268
Domain Number 1 Region: 405-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 236-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 348-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 293-349
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 6 Region: 143-194
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 7 Region: 7-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.98e-19
Family KRAB domain (Kruppel-associated box) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006268   Gene: ENSOANG00000003962   Transcript: ENSOANT00000006270
Sequence length 480
Comment pep:known_by_projection supercontig:OANA5:Contig7223:32467:35345:-1 gene:ENSOANG00000003962 transcript:ENSOANT00000006270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLLMAGSQTPVTFEDVAAYLTREEWRPLDPAQRDLYREVVQENFGDMVSLDFTIGGE
NEVIPKQEVVDEAYGALPGRPKGGGSQELEFDGGGLTARPWGSLAAEGWAGYPPAQVADL
LAQAEALGGGAGTDGAGAGGGRFLKCPECGKGFGQTSDLNRHRRTHSGERPYKCGECGKS
FSRSSHLIQHQRTHTGERPYDCSECGKSFGRSSHLIQHQTTHTGEKPHRCTQCGKSFCRA
SHLIQHQRTHTGERPFACAECGKGFGRSSHLAQHQRTHTGEKPYACGECGRGFSERSDLI
KHYRVHTGERPYRCEDCGKHFSQNSDLVRHRRAHTGERPYECRQCGESFSRISHLAQHRR
THTGERPYECRQCGKGFSRNSHLATHQKTHTGEKPYACGQCGRGFSERSDLVKHQRTHTG
EKPYECAECGKGFTQSSNLLTHQRTHTGERPYECDECGRAFSRSSXXXXXXXXXXXXXXX
Download sequence
Identical sequences F6T4J1
ENSOANP00000006268 ENSOANP00000006268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]