SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006701 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006701
Domain Number 1 Region: 319-433
Classification Level Classification E-value
Superfamily EF-hand 9.25e-43
Family EF-hand modules in multidomain proteins 0.0000165
Further Details:      
 
Domain Number 2 Region: 515-601
Classification Level Classification E-value
Superfamily RING/U-box 6e-17
Family ZZ domain 0.016
Further Details:      
 
Domain Number 3 Region: 148-269
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 4 Region: 21-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000114
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 5 Region: 272-309
Classification Level Classification E-value
Superfamily WW domain 0.0000000000138
Family WW domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006701   Gene: ENSOANG00000004217   Transcript: ENSOANT00000006703
Sequence length 898
Comment pep:known_by_projection ultracontig:OANA5:Ultra519:6862687:6883323:1 gene:ENSOANG00000004217 transcript:ENSOANT00000006703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPAASMNLCWSEIKKKSHSLRARLEAFSDQSGKLQAPLQEIVDWLGHKDEELSAQLPLRG
DVALVQQEKETHPAFMEEVKARGPYIYSVLESAQTFLAQHPFEELEEPQTEGRADVSPRL
RGQNGSRLVWKQATVASELWEKLTARCVDQHRHIERTLEQLLDVRRAMEELDASLGQAEG
VRATWEPIGDLFIDSLPDHIQTTKLFKEELSPMKDGVKLVNDRAHQLAISDVHLSMENSR
ALEQINTRWKQLQTSVSERLKQLQDAHRDFGPGSQHFLTASVQVPWERAISPNKVPYYIN
HQAQTTCWDHRATLTDCTNLAELNNIKFSAYRTAMKLRRVQKALRLDLVPLSTALEIFNE
HELQPGEHVMDVVEVIHCLTALYERLEEERGILVNVPLCVDMTLNWLLNVYDSGRSGKMR
ALSFKTGIACLCGTDVKEKFQSVDSRVVRPFPEEPAHPGQGGSLGRPLGLAPPGTGATPA
CRRSVIHPPHSFPLCPQSTGKPVVEVAQFLEWANLEPQSMVWLAVLHRVALAEPVKHQTK
CSVCRHCPIKGFRYRSLKQFNVDICQMCFLTGRASKGNKLHYPIMEYYTPTTSSENMRDF
ATTLKNKFRSKHYFSRHPQRGYLPVQSVLEADFSETPASSPVLPHADTHSRIGIHHVCSS
PPPCPPWSDVVSDPTPPPHSSRGRDEDQYLLRHSSPITDREPAGGQQAQGSPPGEEDKGT
LEKILAHLEDENRWGATRGARGLGVEVRGEEELVLENAPLAAGTPEAAQDPHNEELLAEA
RILRQHKSRLETRMQILEDHNKQLESQLQRLRELLLQPPADLDGTGSAGSSLASSPQPSE
GSHAREREHNTPDTEVADEIVAKSQDVSLCLEDIMEKLRNAFPNAPSPEPTPNALLAS
Download sequence
Identical sequences F7BL12
ENSOANP00000006701 9258.ENSOANP00000006701 ENSOANP00000006701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]