SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006955 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006955
Domain Number 1 Region: 3-88
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.7e-35
Family SCAN domain 0.0000603
Further Details:      
 
Domain Number 2 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 369-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-20
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 276-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-17
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 167-210
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000209
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006955   Gene: ENSOANG00000004390   Transcript: ENSOANT00000006957
Sequence length 432
Comment pep:known_by_projection supercontig:OANA5:Contig1021:35163:39353:-1 gene:ENSOANG00000004390 transcript:ENSOANT00000006957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRAQRFRRFRYQEASGPREALGRLRELCHLWLRPDRRSKEQILDLLVLEQFLAALPADTQ
AWVRIQRPESGEEAAALVEELEREQDGPGEPGTSLTAWSSSPEPGPSPGRLDCGGGTGAL
GEQGPGKSRAPAAHPSLRNGTHPLLRVPSGPPPGPPGGAEAAAARAVWFQAAVLFADVAV
PLSREEWRSLDADQRAFYREVTLDKYGPRHQMEGGRTWGDSLSPYPFSVRWVLGRELIPL
PSPSPRTGLAFPKPEPRGRRPGTREEASRGRGTPGRYQCGECGRRFSFHSSLSSHRRVHT
GERPYPCPDCGRRFSFRSSLSIHRRVHTGEKPYPCPDCGRVFRQISILTCHRRVHTGERP
YSCSDCGRAFSQSSHLTCHRRVHTGERPYPCPDCGKAFGDRSSLRKHRAIHSGARPYSCG
QCGPPDGKGTQR
Download sequence
Identical sequences F7C898
ENSOANP00000006955 9258.ENSOANP00000006955 ENSOANP00000006955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]