SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007087 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007087
Domain Number 1 Region: 814-870
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-26
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 579-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.38e-25
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 3 Region: 729-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 621-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.18e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 776-807
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000135
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 6 Region: 71-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000418
Family KRAB domain (Kruppel-associated box) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007087   Gene: ENSOANG00000004475   Transcript: ENSOANT00000007089
Sequence length 889
Comment pep:known_by_projection ultracontig:OANA5:Ultra501:1460:13213:-1 gene:ENSOANG00000004475 transcript:ENSOANT00000007089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESQSFQLEPAEPQSGEEFQKLGAWSPTQGSRDQLRPEEESQPLEESAVLIPRVPALPKVE
SDDDWEMAAESQEVLGHLSPAQKDLYGDIGQEHQANEIPLGLPVLKSAVISQLEPGKEMW
KLEFQGFGEERNPRALDLGEGQGRPGQPSARKEVKSWEEQEQWDVEDMKVSGVHWGYEET
KTFLAILGEAPFSEKLRTCHQNRHLYRAIAERLREHGFLRTLEQCRYRVKNLLRSYRKAK
SSHPPGTCPFYEELDALVRARAGVRAADGLEESLYLSRSGGDVDADPEDQEQSGWENEGV
EEAVAFEDCNGDDLVVEELTQESEVSGAPALFQNRVAGVHWGYEETKTFLGILGEAPFSE
KLRTCHQNSQVYRAIAERLRAHGFLRTLEQCRYRFKNLLRSYRKAKSSHPPGTCPFYEEL
DALVRARVGVKAADGLEEFSYLPGPGGSNAEGEDQEQAGWEGEEAGQEAVAASSSTPSCR
TRGFEIQSENEEQNPDRETSEEAVLPRALLENSKDGVSQVLSWKKDCEDECELEPHWAGF
PGERWGKATLEEGLGKLIDQQGLYLVVDKPYKCGECVKSFSRSSHFIAHQRIHTGEKPYK
CLECGKSFSDRSNLNTHQRIHTGEKPYKCLECGKSFSDHSNLVAHQRIHTGEKPYKCGEC
WKSFNQSSNLIKHQRIHAVENSERCGERGDRPPDWPESEPGASKSPTVANHQRIQPGEKL
YSCPECGKSFTKSSALSTHQRMHAGEKPYECPECGKSFRKSSTLASHQRMHTGEKPYECL
ECGKCFSERSKLVTHQRVHSGEKPYKCLECGKNFRDRSNLITHQRIHTGEKPYKCGECGK
CFNQSSSLIIHQRIHTGEKPYKCTECGKDFNNSSHFSAHRRIHAVERQK
Download sequence
Identical sequences F7DN36
ENSOANP00000007087 9258.ENSOANP00000007087 ENSOANP00000007087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]