SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007483 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOANP00000007483
Domain Number - Region: 62-148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007483   Gene: ENSOANG00000004725   Transcript: ENSOANT00000007485
Sequence length 309
Comment pep:known_by_projection supercontig:OANA5:Contig854:32783:61569:1 gene:ENSOANG00000004725 transcript:ENSOANT00000007485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSPCGFNSRPRPLVFALRPLPTSFFRLQAERLAKHMSVYQQDLAPDITTDASYAAEAKEA
LINECEELWKQMEECQNKLSSLGPETLTDSDAQLSLLIMRVKGLTAERNQWQKRTPEIVP
NNQDILSALGKEELQKLDQDLEMVLSAVQAQNVKLKEDLRREQQWLNEQEQLIESLKVTH
DELKTQEVHFSEERAVRELKSKMIKIKAYKEELLSALGEFLDNHFPLPEEDENVKKKKKK
KCAGPTVQLISLHEILEILISKLLTAPHEPYVAIQDSFWPPYIELLLRSGIALRHPEDPN
RIRLEAFHQ
Download sequence
Identical sequences F7DL42
9258.ENSOANP00000007483 ENSOANP00000007483 ENSOANP00000007483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]