SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007675 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007675
Domain Number 1 Region: 85-145
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-24
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 2 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.74e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 499-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.49e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 556-612
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.16e-20
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 6 Region: 296-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000217
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 444-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000369
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 8 Region: 602-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000055
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007675   Gene: ENSOANG00000004845   Transcript: ENSOANT00000007677
Sequence length 634
Comment pep:known_by_projection supercontig:OANA5:Contig13310:8077:17774:-1 gene:ENSOANG00000004845 transcript:ENSOANT00000007677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALLTSRSSSSPQLERVEVKSEREPQNELERSPEPGSEEQLSPDLEIESPADQERALPV
PWVPAIPKEESLEDEVTTEYLLPKPQELVTFEDVALYFSWEEWARLEAVQRNLYKDVMRE
NYGILMSLGFPIPKPEVISQLERGEEPWVPDLPGSEDVARIPCLSSAWAEQPLRLPQGFV
QCSGKSLNIGSSLQCFSNDIPESRKQQQDLETLVRRKPSGLEFENPAVCLSSFLTRPQSS
KCLTAPDLNAGRHCVCAPGPRLCCSFQEQEASWSSVKGFWRCSKVARAAGGRPETTCDVC
GKVFPHRSGLAKHRRYHAAVKPFGCEECGKGFVYRSHLAIHQRTHTGEKPFPCPDCGKRF
VYKSHLVTHRRIHTGERPYRCPFCGAGFGRRSYLVTHQRTHTGERPYPCPHCGRSFSQSS
ALARHQAVHTAEKPHHCPDCGRGFRLRADFQRHRRGGRDETPWICSDCGKTFGRRAALAK
HQRYHAGERPHRCIDCGKSFVYGSHLARHRRTHTGERPFPCPECGARFARGSHLAAHVRG
HTGEKPFVCGVCGAGFSRRAHLTAHGRAHTGERPYACGECGRRFGQSAALTRHQWAHAEE
KPHRCPDCGKGFGHSSDFKRHRRTHTGEKPFRCA
Download sequence
Identical sequences F7DTK5
ENSOANP00000007675 ENSOANP00000007675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]