SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000007905 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000007905
Domain Number 1 Region: 71-136
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000203
Family HkH motif-containing C2H2 finger 0.052
Further Details:      
 
Domain Number 2 Region: 13-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000124
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000007905   Gene: ENSOANG00000004985   Transcript: ENSOANT00000007907
Sequence length 258
Comment pep:novel ultracontig:OANA5:Ultra239:2748019:2757699:-1 gene:ENSOANG00000004985 transcript:ENSOANT00000007907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEITSKVEKKPTTATGNSTCPSVETEEEKAKRLLYCSLCKVAVNSASQLEAHNSGTKH
KTMLEARNGSGTIKAFPRAGVKGKGPVNKGNTGLQNKTFHCEICDVHVNSETQLKQHISS
RRHKDRAAGKPPKPKYSPYNKLQKFHLLLPSVIARCCRLKHIHLHGRSCLNLQSSTAVFL
QVKLVFSKEPSKPLAPRILPNPLAAAAAAAAVAVNSPFSLRTAPAATLFQTSALPPALLR
PAPGPIRTTHTPVLFAPY
Download sequence
Identical sequences F7CX87
ENSOANP00000007905 ENSOANP00000007905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]