SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008268 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008268
Domain Number 1 Region: 331-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.47e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 219-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 5 Region: 163-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 12-55
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-17
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 471-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000184
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008268   Gene: ENSOANG00000005204   Transcript: ENSOANT00000008270
Sequence length 523
Comment pep:novel supercontig:OANA5:Contig10280:2525:16431:-1 gene:ENSOANG00000005204 transcript:ENSOANT00000008270 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAVPPPPPRTQHGLVTFEDVAVTFTRAEWEHLDSAQCSLHWQVMLENYRNLTSLLIINMS
NPPPPKKKQKQSEAEHNLHVEGEIDCKIGTEIESIPSKRDRVEEADLHRVLLGSLQQNIL
MASEDGKTCDTEGRLGKPRRNPTVRRLNKFPDQEKGSSECEKAFIWSSYLTQRPKIHPGE
KPHKCNECGKAFRWSSGLIEHQRIHTGEKPYKCNECGKAFSCSSTFIGHQRIHTGEKPYQ
CNECGKAFSHHSALVRHQRIHTGEKPFKCSECGKVFSRHSTLIQHQRIHTGERPYQCSDC
GKAFSQHSALIGHQRIHTGEIPYKCNECGKAFSYQSVLIRHQIIHTGERPYQCNDCGKAF
SHHSALITHQRIHTGEKPYKCNECGKAFSQHSVLINHQRIHTGEKPYQCNECGKAYRQHS
ALIGHQRIHTGEKPYKCNECGKAFSLLSPLIGHQRIHTGEKPYKCNECGKAFSQHSHLNN
HQRIHTRDTAQIECGRVFIQWPVSEIFFHRKIHTTQKPFKCGQ
Download sequence
Identical sequences F7C5V5
ENSOANP00000008268 ENSOANP00000008268 9258.ENSOANP00000008268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]