SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008304 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008304
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.33e-37
Family SCAN domain 0.0000389
Further Details:      
 
Domain Number 2 Region: 394-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.86e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 4 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.79e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 580-632
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-21
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 6 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 239-275
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000628
Family KRAB domain (Kruppel-associated box) 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000008304
Domain Number - Region: 557-576
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0402
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008304   Gene: ENSOANG00000005226   Transcript: ENSOANT00000008306
Sequence length 657
Comment pep:novel supercontig:OANA5:Contig1411:103753:112875:-1 gene:ENSOANG00000005226 transcript:ENSOANT00000008306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATELEEGARPLSPQILAPKKQEESPLMKLGGNSAHGRGSTLTGGDPGPESFRQRFRRFR
YQEADGPRKAHGQLWELCRRWLRPEVRTKEQILDLLVLEQFLTVLPGDIQSQVREQCPRS
GEEAVAMVEDLRKQPGTPRPWVSGWARGQAVPSEETTNREKVQPPPSLMPKSAKPQPYVG
SQEEQEQDRPPQLEEQPNYDPKGELLFRTERALPAPQVPALPRAAGARDREMAAALLSAW
SQMPVMLEDVAVYLSREQWARLDPAQRGLCRDGMQGFEIRSQKDEGSFVDMETQQRISKK
CEGAIPQNPEWGEICENEGRSKKQQEHPQGKVALQKRGFRDLADLIAHKKSLAGEKPHKC
SECGRRFHRSTELSQHRQTHTGEKPHKCSDCGKTFSWSSHLIQHQRIHTGEKPYECRECG
KTFSWSSNLIQHQRNHTGEKPHKCSECGKSFGQNSDLRKHQRTHTGDKPYKCDECGKSFP
TSLELTQHQRIHMGEKPYECSECGKTFSWSSHLIQHQRIHTGEKPFECSECGKTFSWSSN
LIQHQRNHTGEKPHKCGDCGKSFSQSSDLRKHQRTHTGEKPHKCSDCGKCFSRSSSLIMH
QRTHTGEKPYECNECGKSFSRSSNLIQHQRIHAAQAPYVVLNLDSSGTAFPTTSPTS
Download sequence
Identical sequences F6XAN0
ENSOANP00000008304 ENSOANP00000008304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]