SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008305 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008305
Domain Number 1 Region: 225-282
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-19
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 185-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5e-19
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 4 Region: 68-110
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000000314
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008305   Gene: ENSOANG00000028662   Transcript: ENSOANT00000008307
Sequence length 331
Comment pep:known_by_projection supercontig:OANA5:Contig1411:91648:97270:-1 gene:ENSOANG00000028662 transcript:ENSOANT00000008307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLGGARGSSSFRQGEPKGVSQEEGAWTPHPGLQEQQIGDSRRAPRIPVLLKEGSTREM
VDAFFSAGSQGPMTFGDVPFYLSREEWGCLDPAQRDLFWDMKRENFRNISLGLGIKSQNE
KIPYQASLEDVESPPRPPEGSMPWSPEEGEAWESENGPERQLGRPTGVRRGRPPTRRREF
RDLAAEKPHSCEQCGKRFRWGSDLARHQRTHTGEKPHKCQECEKSFRSSSDLVRHQGVHT
GEKPFTCNECGKSFSRSAYLADHQRIHTGEKPYECGDCGKSFSLRSYLLDHRRVHTGERP
FGCTECDKSFKQRAHLIAHQSLHAKMGAQSV
Download sequence
Identical sequences F6XAM1
ENSOANP00000008305 ENSOANP00000008305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]