SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008435 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008435
Domain Number 1 Region: 1815-1939
Classification Level Classification E-value
Superfamily EF-hand 1.83e-50
Family EF-hand modules in multidomain proteins 0.00000531
Further Details:      
 
Domain Number 2 Region: 1941-2036
Classification Level Classification E-value
Superfamily EF-hand 1.77e-37
Family EF-hand modules in multidomain proteins 0.0000154
Further Details:      
 
Domain Number 3 Region: 893-1049
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 2016-2104
Classification Level Classification E-value
Superfamily RING/U-box 8.71e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 5 Region: 1478-1606
Classification Level Classification E-value
Superfamily Spectrin repeat 3.96e-19
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 6 Region: 1254-1412
Classification Level Classification E-value
Superfamily Spectrin repeat 2.33e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 7 Region: 1655-1774
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000196
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 8 Region: 461-616
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000028
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 9 Region: 150-303
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000122
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 10 Region: 1020-1156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000275
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 11 Region: 1777-1814
Classification Level Classification E-value
Superfamily WW domain 0.0000000000757
Family WW domain 0.00024
Further Details:      
 
Domain Number 12 Region: 52-158
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000237
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 13 Region: 590-714
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000027
Family Spectrin repeat 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000008435
Domain Number - Region: 275-409
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000252
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 1206-1270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0173
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008435   Gene: ENSOANG00000005298   Transcript: ENSOANT00000008437
Sequence length 2406
Comment pep:novel chromosome:OANA5:2:16552787:16963602:-1 gene:ENSOANG00000005298 transcript:ENSOANT00000008437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVKDFLMKEQAVQGDCDGLQRQLDQCTEFVNKIDMIESTLKEMKDIEATLRSQPVTGV
KTWLQTKLVDYQSHWEKYSKQIALQKNRLSESQEKAVNLKKDLAEMQEWMTQAEEEYLEK
DFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAKVPSGGQELTSELNIVL
ENYQLLCNRIRGKCHTLEEVWSCWIELLQYLDLETAWLNTLEERVQSTETLLDKADAVNE
ALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEIFNSRYEELSHLAENKQIS
LEQQLQTLQDTDHMLQVLQESLAELDKQLTTYLTDRVDAFQVPQEAQKIQAEISSHELTL
EELRRSVRSQVPSTPEGRSPRGGSQLDVLQRKLREVFTKYQLFQKPANFEQRMLDCKRVL
DGVKAELHVLDVKDTDPDVIQTHLDRCMKLYKTLSEVKLEVETVIKTGRQIVQKQQTDNP
KGMDEQLTALKFLYNDLGAQVTEGKQDLERASQLARKIKKEVASLSDWLSVTEAELVQKS
TAEGSVSDLDSEIAWAKNTLKDLEKRKADLNTITESSTALQSLVEGSETILEEKLCVLNA
GWSRVRTWTEDWCNTLLNHQNQLEIFDGNVAHISTWLYQAEALLDEIEKKPANKREEIVK
RLISELDDASLRVENARDQAIILMNSRGVACNELVEPKLSELNRNFEKVSQHIKSAKILI
NQEPLSYKMFVKPEPYEVTLPSADLEILERDLENMLRVVERHLESSDEDEKMDEEKAQIE
EVLQRGEQMLQQPIEANKREKIRLQLLLLQTRHNNIKAVPSQQRVTGQYPPGIGSSALPT
DYLVEINKILLSMADVELLLNAPELNAGVYEDFSIQEDSLKNIKDLLDRLGDQIAVIHEK
QPDVILEASGPEAVQIGDSLTQLNAKWDRINRMYNDRKGYFDRAVEEWRQFHCDINDLSQ
WVSEAEQLLADAQAPDGSVDIQKAEMHQQELEEGVSSHQSNISALNRTGEGIIQKLSTAD
GSFLQEKLAGLNNRWSRIETEVMDRQQRLKGESEQLMEYKKQMDEIDCWIERAENTVEIR
SFSKPEEKLQEFKGLAKETEIQAEKLKWLTRTEPEMLLHKSLDSREREKISERLRTLNIK
WNKVSRKISSTVQDLEGYGQDPCYVTQSKLSAYPMAQKVVLVSSTSEIPAQTQLALELSL
PADLDKTTTELADWLILIDQMLKSNIVTVGSAEEINQTIARMKITMADLEQRHPQLDSVF
TLAQNLKNKTSSSDVRTAITEKLEKVKNQWDNTQHGVEVRQQQLQDMLSDSLQWNDQRQE
TEQLFRHYEVRFHTLLQAPKEPLVKQLPENKVLAQEMHRGEITIAAFNDLSKKLLRDYSE
DDTRKVKETTDHLNTSWINLNQSIGDRQNALEAELRTLQASLKDLEIFLKWMQEAETTVN
VLADASQRENALQDDVLMREFKKQMKDIQAEIDAHNDIFKSIDGNRQKMVKALGNSDEAA
LLQHRLDDMNQRWNDLKAKSASIRAHLEASAEKWNRLLASLEELVKWLNLKDEELNQQMP
IGGDVPALQQQYDHCKALRRELKDKEQTVLNAVDQARVFLADQPVEGLEESRRHLQSKTE
LTPEEKAQRIAKTMRKQSSEVKGKWESLNAVTSSWQKQVDKALEKLKDLQGAMDDLDADM
KEAETVRNGWKPVGDLLIDSLQDHIDKTTAFREEIAPISLKVKTVNDLSSQLSPLDLHPS
LKMSRQLDDLNMRWKLLQVSVEDRLKQLQEAHRDFGPSSQHFLSTSVQLPWQRSVSHNKV
PYYINHQTQTTCWDHPKMTELFQSLADLNNVRFSAYRTAIKIRRLQKALCLDLLELNTTN
EVFQQHKLNQNDQLLSVPDVINCLTTTYDGLEQKHKDLVNVPLCVDMCLNWLLNVYDTGR
TGKIRVQSLKIGLISLSKGLLEEKYRYLFKEVAGPTEMCDQRQLGLLLHDAIQIPRQLGE
VAAFGGSNIEPSVRSCFQQNNNKPEINVKQFIDWMRLEPQSVVWLPVLHRVAAAETAKHQ
AKCNICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLHYPMVEYCIPTTSGEDVR
DFTKVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNLETPITLISMWPEQYDPSQSPQLFH
DDTHSRIEQYATRLAQMERTNGSLLTDSSSTTGSVEDEHSLIHQYCQTLGGESPVSQPQS
PAQILKSVEREERGELERIISDLEEEQRILQVEYEQLKEQHLKRGISPLSSPPDSVVSPQ
HLSGDSELIAEAKLLRQHKGRLEARMQILEDHNKQLESQLHRLRQLLEQPESNARINGIS
PWSSPQHSALSYSLDQDPSSQFQQTAADDLLVPPQPTSTDLTDVMEQINSTFPSCHFNYP
SPPLAI
Download sequence
Identical sequences F7CSP6
ENSOANP00000008444 ENSOANP00000008435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]