SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008443 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008443
Domain Number 1 Region: 1635-1791
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 25-134
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-20
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 103-242
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1996-2154
Classification Level Classification E-value
Superfamily Spectrin repeat 2.81e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 209-350
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 674-794
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000456
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 7 Region: 1203-1358
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000246
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 8 Region: 892-1045
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000012
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 1762-1898
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000249
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 801-902
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000252
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 11 Region: 1332-1456
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000264
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 12 Region: 403-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000204
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 13 Region: 580-696
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000336
Family Spectrin repeat 0.017
Further Details:      
 
Domain Number 14 Region: 1017-1151
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000672
Family Spectrin repeat 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000008443
Domain Number - Region: 509-616
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00736
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 1948-2013
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0144
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008443   Gene: ENSOANG00000005298   Transcript: ENSOANT00000008445
Sequence length 2208
Comment pep:novel chromosome:OANA5:2:16840261:17003819:-1 gene:ENSOANG00000005298 transcript:ENSOANT00000008445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQNTAPEEHEGLRAETPSMVTEVDMDLDSYQEALEEVLTWLLSAEDTFQEQDDISKDVEQ
VKDQFATHEAFMMKLTAHQSSVGSVLQAGNQLIAQGNLSEEEEYEIQEQMTLLNSRWEAL
RVDSMDRQSRLHDVLMELQKKQLQQLSDWLTVTEERIQKMETFPLDDDLQSLQKQLKEHK
ALQNDLEAEQVKVNSLTHMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEDRWNKL
QEINLLWQELLEEQCLLKAWLTEKEEALNKVQTSNFKDQTELSVNVRRLAILKEDMEMKR
QTLDQLSEIGQDVGQLLSNPRASKKIISDSEKLTERWDCLVQKLEDFSNQVTQAVAKLGM
AQAPQRILTETVSTREGKKSKQELPPPPPPKKRQIHVDTEVKKKFDVENAELLNWILQSK
AAIQATEIKEFKKMRDTMDLKEKLKVLEKERAERNPKLDELNQDGRNLLEQMEKEGLPTE
DMKNALEKTVTQWNDIVRCLEDAARKIRLQEDINSYFRELGTLEKTIKEKEEWVKNALTS
LQQLSPGLKDSCQRELTHLLSLCPRVEKLSASCVTLKSQPAVPNFIQKSLDSFMDRYTSV
RQKLEGCQQHSEKELRSQPRQGYMEALQRLKDALSDTESRAQVTLSTLSDPSKVEKALQQ
KKMLDEILEDQKPVLCQLAEEAKALEKQTPSDLGKIYKQEYETLKEKWDKLKSKVTKDAD
ILEEIIPKLRVFEADSKVIQKWMDGVKDFLMKEQAVQGDCDGLQRQLDQCTEFVNKIDMI
ESTLKEMKDIEATLRSQPVTGVKTWLQTKLVDYQSHWEKYSKQIALQKNRLSESQEKAVN
LKKDLAEMQEWMTQAEEEYLEKDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNI
KLLAAKVPSGGQELTSELNIVLENYQLLCNRIRGKCHTLEEVWSCWIELLQYLDLETAWL
NTLEERVQSTETLLDKADAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISE
KLEIFNSRYEELSHLAENKQISLEQQLQTLQDTDHMLQVLQESLAELDKQLTTYLTDRVD
AFQVPQEAQKIQAEISSHELTLEELRRSVRSQVPSTPEGRSPRGGSQLDVLQRKLREVFT
KYQLFQKPANFEQRMLDCKRVLDGVKAELHVLDVKDTDPDVIQTHLDRCMKLYKTLSEVK
LEVETVIKTGRQIVQKQQTDNPKGMDEQLTALKFLYNDLGAQVTEGKQDLERASQLARKI
KKEVASLSDWLSVTEAELVQKSTAEGSVSDLDSEIAWAKNTLKDLEKRKADLNTITESST
ALQSLVEGSETILEEKLCVLNAGWSRVRTWTEDWCNTLLNHQNQLEIFDGNVAHISTWLY
QAEALLDEIEKKPANKREEIVKRLISELDDASLRVENARDQAIILMNSRGVACNELVEPK
LSELNRNFEKVSQHIKSAKILINQEPLSYKMFVKPEPYEVTLPSADLEILERDLENMLRV
VERHLESSDEDEKMDEEKAQIEEVLQRGEQMLQQPIEANKREKIRLQLLLLQTRHNNIKA
VPSQQRVTGQYPPGIGSSALPTDYLVEINKILLSMADVELLLNAPELNAGVYEDFSIQED
SLKNIKDLLDRLGDQIAVIHEKQPDVILEASGPEAVQIGDSLTQLNAKWDRINRMYNDRK
GYFDRAVEEWRQFHCDINDLSQWVSEAEQLLADAQAPDGSVDIQKAEMHQQELEEGVSSH
QSNISALNRTGEGIIQKLSTADGSFLQEKLAGLNNRWSRIETEVMDRQQRLKGESEQLME
YKKQMDEIDCWIERAENTVEIRSFSKPEEKLQEFKGLAKETEIQAEKLKWLTRTEPEMLL
HKSLDSREREKISERLRTLNIKWNKVSRKISSTVQDLEGYGQDPCYVTQSKLSAYPMAQK
VVLVSSTSEIPAQTQLALELSLPADLDKTTTELADWLILIDQMLKSNIVTVGSAEEINQT
IARMKITMADLEQRHPQLDSVFTLAQNLKNKTSSSDVRTAITEKLEKVKNQWDNTQHGVE
VRQQQLQDMLSDSLQWNDQRQETEQLFRHYEVRFHTLLQAPKEPLVKQLPENKVLAQEMH
RGEITIAAFNDLSKKLLRDYSEDDTRKVKETTDHLNTSWINLNQSIGDRQNALEAELRTL
QASLKDLEIFLKWMQEAETTVNVLADASQRENALQDDVLMREFKKQMK
Download sequence
Identical sequences F7CS62
ENSOANP00000008443 9258.ENSOANP00000008443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]