SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008444 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008444
Domain Number 1 Region: 1622-1778
Classification Level Classification E-value
Superfamily Spectrin repeat 3.17e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 19-128
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-20
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 98-236
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-18
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1983-2141
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 5 Region: 203-344
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-16
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 6 Region: 668-788
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000468
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number 7 Region: 1197-1352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000212
Family Spectrin repeat 0.0064
Further Details:      
 
Domain Number 8 Region: 886-1039
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000133
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 9 Region: 1749-1885
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000249
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 1326-1451
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000264
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 11 Region: 795-893
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000432
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 12 Region: 397-496
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000144
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 13 Region: 574-688
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000272
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000008444
Domain Number - Region: 1011-1145
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000288
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 503-610
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00736
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number - Region: 1935-2000
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0142
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008444   Gene: ENSOANG00000005298   Transcript: ENSOANT00000008446
Sequence length 2195
Comment pep:novel chromosome:OANA5:2:16840261:17003801:-1 gene:ENSOANG00000005298 transcript:ENSOANT00000008446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEHEGLRAETPSMVTEVDMDLDSYQEALEEVLTWLLSAEDTFQEQDDISKDVEQVKDQFA
THEAFMMKLTAHQSSVGSVLQAGNQLIAQGNLSEEEEYEIQEQMTLLNSRWEALRVDSMD
RQSRLHDVLMELQKKQLQQLSDWLTVTEERIQKMETFPLDDDLQSLQKQLKEHKALQNDL
EAEQVKVNSLTHMVVIVDENSGESATAVLEDQLQKLGERWTAVCRWTEDRWNKLQEINLL
WQELLEEQCLLKAWLTEKEEALNKVQTSNFKDQTELSVNVRRLAILKEDMEMKRQTLDQL
SEIGQDVGQLLSNPRASKKIISDSEKLTERWDCLVQKLEDFSNQVTQAVAKLGMAQAPQR
ILTETVSTREGKKSKQELPPPPPPKKRQIHVDTEVKKKFDVENAELLNWILQSKAAIQAT
EIKEFKKMRDTMDLKEKLKVLEKERAERNPKLDELNQDGRNLLEQMEKEGLPTEDMKNAL
EKTVTQWNDIVRCLEDAARKIRLQEDINSYFRELGTLEKTIKEKEEWVKNALTSLQQLSP
GLKDSCQRELTHLLSLCPRVEKLSASCVTLKSQPAVPNFIQKSLDSFMDRYTSVRQKLEG
CQQHSEKELRSQPRQGYMEALQRLKDALSDTESRAQVTLSTLSDPSKVEKALQQKKMLDE
ILEDQKPVLCQLAEEAKALEKQTPSDLGKIYKQEYETLKEKWDKLKSKVTKDADILEEII
PKLRVFEADSKVIQKWMDGVKDFLMKEQAVQGDCDGLQRQLDQCTEFVNKIDMIESTLKE
MKDIEATLRSQPVTGVKTWLQTKLVDYQSHWEKYSKQIALQKNRLSESQEKAVNLKKDLA
EMQEWMTQAEEEYLEKDFEYKSPEELESAVEEMKRAKEDVLQKEVRVKILKDNIKLLAAK
VPSGGQELTSELNIVLENYQLLCNRIRGKCHTLEEVWSCWIELLQYLDLETAWLNTLEER
VQSTETLLDKADAVNEALESLESVLRHPADNRTQIRELGQTLIDGGILDDIISEKLEIFN
SRYEELSHLAENKQISLEQQLQTLQDTDHMLQVLQESLAELDKQLTTYLTDRVDAFQVPQ
EAQKIQAEISSHELTLEELRRSVRSQVPSTPEGRSPRGGSQLDVLQRKLREVFTKYQLFQ
KPANFEQRMLDCKRVLDGVKAELHVLDVKDTDPDVIQTHLDRCMKLYKTLSEVKLEVETV
IKTGRQIVQKQQTDNPKGMDEQLTALKFLYNDLGAQVTEGKQDLERASQLARKIKKEVAS
LSDWLSVTEAELVQKSTAEGSVSDLDSEIAWAKNTLKDLEKRKADLNTITESSTALQSLV
EGSETILEEKLCVLNAGWSRVRTWTEDWCNTLLNHQNQLEIFDGNVAHISTWLYQAEALL
DEIEKKPANKREEIVKRLISELDDASLRVENARDQAIILMNSRGVACNELVEPKLSELNR
NFEKVSQHIKSAKLSLGRPPGGEPYEVTLPSADLEILERDLENMLRVVERHLESSDEDEK
MDEEKAQIEEVLQRGEQMLQQPIEANKREKIRLQLLLLQTRHNNIKAVPSQQRVTGQYPP
GIGSSALPTDYLVEINKILLSMADVELLLNAPELNAGVYEDFSIQEDSLKNIKDLLDRLG
DQIAVIHEKQPDVILEASGPEAVQIGDSLTQLNAKWDRINRMYNDRKGYFDRAVEEWRQF
HCDINDLSQWVSEAEQLLADAQAPDGSVDIQKAEMHQQELEEGVSSHQSNISALNRTGEG
IIQKLSTADGSFLQEKLAGLNNRWSRIETEVMDRQQRLKGESEQLMEYKKQMDEIDCWIE
RAENTVEIRSFSKPEEKLQEFKGLAKETEIQAEKLKWLTRTEPEMLLHKSLDSREREKIS
ERLRTLNIKWNKVSRKISSTVQDLEGYGQDPCYVTQSKLSAYPMAQKVVLVSSTSEIPAQ
TQLALELSLPADLDKTTTELADWLILIDQMLKSNIVTVGSAEEINQTIARMKITMADLEQ
RHPQLDSVFTLAQNLKNKTSSSDVRTAITEKLEKVKNQWDNTQHGVEVRQQQLQDMLSDS
LQWNDQRQETEQLFRHYEVRFHTLLQAPKEPLVKQLPENKVLAQEMHRGEITIAAFNDLS
KKLLRDYSEDDTRKVKETTDHLNTSWINLNQSIGDRQNALEAELRTLQASLKDLEIFLKW
MQEAETTVNVLADASQRENALQDDVLMREFKKQMK
Download sequence
Identical sequences F7CS56
ENSOANP00000008444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]