SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009504 from Ornithorhynchus anatinus 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009504
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-22
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 2 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-20
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 160-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 270-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.31e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 199-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000255
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 400-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000381
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009504   Gene: ENSOANG00000005971   Transcript: ENSOANT00000009506
Sequence length 445
Comment pep:novel supercontig:OANA5:Contig3654:7808:12813:1 gene:ENSOANG00000005971 transcript:ENSOANT00000009506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSPPGSRLQGSGLGRGSSDRGSRATVPVTFEDVAVYFSREEWAALDGRQKELYRDVMRGN
YELVASLGCPAAKPDLICQIERDEELGVGEPQGRPVRRQPQRRSSENLDSGSLEEWRCPG
SKGGPPRCRKRRRRPGIPGLGNLAEKPPGGTLRGLPSRKKPPTCPECDKSFKSNTALTIH
ERSHTGERPFKCPDCGKGFPSKGDLKRHQKTHVGERKAHTCPRCEKTFRNGRDLTKHQRS
HTAERPFGLPFIAGAAFRGPRTSRSTRGAHTAERPFACLQCGSRFRLKQILVSHQRIHGG
ERPFHCGDCGKTFGQKHHLLSHRRTHTGERPFSCVQCGHSFSQKHHLVSHRRIHTGERPF
PCPDCGKRFKDKKTLIIHGRVHSGERPYSCAQCGKTCSQKQHLKSHLRTHQLRPEKPHKC
GKCEKSFRDERIMLAHRGTHAEETP
Download sequence
Identical sequences F6XV45
ENSOANP00000009504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]